Saccharolobus sp. E5-1-F: GFS03_09405 Help Entry GFS03_09405       CDS       T06918                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sule  Saccharolobus sp. E5-1-F Pathway sule03010   Ribosome Brite KEGG Orthology (KO) [BR:sule00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     GFS03_09405   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     GFS03_09405  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sule03011]     GFS03_09405    04121 Ubiquitin system [BR:sule04121]     GFS03_09405   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sule04147]     GFS03_09405 Ribosome [BR:sule03011]  Ribosomal proteins   Eukaryotes    Small subunit     GFS03_09405   Archaea     GFS03_09405 Ubiquitin system [BR:sule04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    GFS03_09405 Exosome [BR:sule04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GFS03_09405   Exosomal proteins of colorectal cancer cells    GFS03_09405 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_ribbon_SprT Cas12f1-like_TNB YPEH2ZP UPF0179 Zn_ribbon_RPB9 Zn_ribbon_PriA Zn_ribbon_Nudix DUF5795 Zn_Ribbon_1 Lar_restr_allev DUF7838 YhfH FlhC ComFA_N Zn_ribbon_13 zf-tcix Zn_ribbon_3 DUF1451 DUF6758 Zn_ribbon_ACC Motif Other DBs NCBI-ProteinID:  QGA54776 LinkDB All DBs Position 1822927..1823118 Genome browser AA seq 63 aa AA seqDB search MAKEQKVKAIVRTYYVIEGNKIKLKNKKCPRCGSIMAHHLKPNERWSCGKCGYTEFIGTS KKR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt gtggccaaggagcaaaaggttaaagcaatagtaagaacttattatgtaatagaagggaat aagattaagctaaaaaataagaaatgccctaggtgcggaagcataatggctcatcactta aaaccaaatgagagatggtcttgtggaaagtgtggttacactgagtttataggcacttca aagaaaagataa

DBGET integrated database retrieval system