Sulfuriferula sp. AH1: CAP31_03740 Help Entry CAP31_03740       CDS       T04857                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism sulf  Sulfuriferula sp. AH1 Brite KEGG Orthology (KO) [BR:sulf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sulf03032]     CAP31_03740    03036 Chromosome and associated proteins [BR:sulf03036]     CAP31_03740    03400 DNA repair and recombination proteins [BR:sulf03400]     CAP31_03740 DNA replication proteins [BR:sulf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CAP31_03740 Chromosome and associated proteins [BR:sulf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CAP31_03740 DNA repair and recombination proteins [BR:sulf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CAP31_03740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  ARU30874 UniProt:  A0A1Y0G675 LinkDB All DBs Position 720613..720864 Genome browser AA seq 83 aa AA seqDB search MKLQHNRAVNKADVSAFLESLATASTIALATGGEVMLPDICKISVTTRAARTGRNPATGA EVEIPAKRVPAFKAVKALKDAVA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaagctgcagcacaaccgcgctgtcaacaaggctgatgtttctgcattccttgagtca ctggcaactgccagcaccattgcgctggccaccggtggcgaagttatgctgccagacatc tgcaagatcagcgtcaccacccgcgccgcgcgcactggccgcaaccctgccaccggcgca gaagtcgaaatcccggccaagcgcgtgccagcattcaaagcggtaaaggccttgaaggac gccgtagcctaa

DBGET integrated database retrieval system