Sulfuriferula sp. AH1: CAP31_13700 Help Entry CAP31_13700       CDS       T04857                                  Name (GenBank) hypothetical protein   KO K03741   arsenate reductase (thioredoxin) [EC:1.20.4.4] Organism sulf  Sulfuriferula sp. AH1 Brite KEGG Orthology (KO) [BR:sulf00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CAP31_13700 Enzymes [BR:sulf01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.4  arsenate reductase (thioredoxin)      CAP31_13700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  ARU32634 UniProt:  A0A1Y0GB95 LinkDB All DBs Position complement(2722986..2723285) Genome browser AA seq 99 aa AA seqDB search MEVRAAVLPGVPGEVEVIDEELLVWADLLVTLDAAALAARPPLRSGLQHRHYPFEPIPPA NDKAAWSELAARVRERVEGMIGGMRLLEKAAQAAASDDL NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggaggtgcgcgctgcagttttgccaggggtgccgggcgaagtcgaggtgatcgatgaa gagctgctggtctgggcggatctgctggtgacgctcgatgccgcggctttggccgcgcgt ccgccattacgcagtggcttgcaacatcggcattacccgtttgaaccgatcccgccagca aacgataaagcggcctggagcgaactggctgcgcgcgtacgcgagcgggtggaaggaatg ataggtggcatgcgcttgctggaaaaagccgcgcaagccgccgcctcggatgatttataa

DBGET integrated database retrieval system