Sulfurimonas lithotrophica: FJR48_08720 Help Entry FJR48_08720       CDS       T06298                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sulg  Sulfurimonas lithotrophica Pathway sulg01100   Metabolic pathways sulg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sulg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FJR48_08720 (acpP)    00074 Mycolic acid biosynthesis     FJR48_08720 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FJR48_08720 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N PRD Motif Other DBs NCBI-ProteinID:  QFR49808 UniProt:  A0A5P8P253 LinkDB All DBs Position complement(1742183..1742410) Genome browser AA seq 75 aa AA seqDB search MALLDDIKEVVVEQLSVSADEVKEDAKFVEDLGADSLDVVELVMALEEKFDIEIPDDEAE KIQTVKDVVDYIESK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcacttttagatgatattaaagaagtagtagttgagcagttaagcgttagcgctgat gaagtaaaagaggacgcaaagttcgttgaagatttaggtgctgatagccttgatgttgtt gaactagtaatggctcttgaagagaaatttgatatcgaaattccagatgatgaagctgaa aagattcaaactgttaaagatgtagtagattatatcgaaagcaaataa

DBGET integrated database retrieval system