Sulfurimonas lithotrophica: FJR48_10860 Help Entry FJR48_10860       CDS       T06298                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sulg  Sulfurimonas lithotrophica Pathway sulg01100   Metabolic pathways sulg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sulg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FJR48_10860    00074 Mycolic acid biosynthesis     FJR48_10860   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FJR48_10860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QFR50202 UniProt:  A0A5P8P394 LinkDB All DBs Position 2177996..2178256 Genome browser AA seq 86 aa AA seqDB search MVTKEEIFEKVKTTLINDFEIEDDEVVLDAHIYKDLDLDSLDAIDLMVTLDKQLGIETKP EEMKNLATIDDVCNFIVDTVTAKENG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggtaacaaaagaggaaatttttgagaaagtaaaaactactttaataaatgacttcgaa atagaagatgatgaagtagtactagacgctcatatctataaagacttagatttagacagc ttagatgcaattgacttaatggttacactcgataaacaactcgggattgaaactaaacct gaagaaatgaaaaatttggcaactatcgatgatgtttgcaactttattgtagatactgta acagccaaagaaaatggctaa

DBGET integrated database retrieval system