Sulfitobacter sp. JL08: C1J05_02790 Help Entry C1J05_02790       CDS       T05585                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism suli  Sulfitobacter sp. JL08 Pathway suli00190   Oxidative phosphorylation suli01100   Metabolic pathways Module suli_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:suli00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     C1J05_02790 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:suli00194]     C1J05_02790 (atpE) Photosynthesis proteins [BR:suli00194]  Photosystem and electron transport system   F-type ATPase [OT]    C1J05_02790 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C XdhC_CoxI Motif Other DBs NCBI-ProteinID:  AXI53570 LinkDB All DBs Position complement(539890..540168) Genome browser AA seq 92 aa AA seqDB search MDPSTLIAAVSIVTAGLTIAIGSIGPAFAEGRAAAQALQALAQQPDASDTITRTLFVSLA MIESTAIYCFVVSMILIFANPFTDMVQQAAGG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggatccctcaacgctgatcgccgccgtttcgatcgtgaccgcaggtctgaccatcgcc atcgggtccattggtcccgcgttcgccgaagggcgggcagcggcacaagcgcttcaggca ctggcgcaacagcccgatgcgtccgacacgatcacccggacacttttcgtcagtctggcg atgattgaatcgactgccatctattgctttgtcgtttcgatgatcctgatttttgccaac ccgttcacggacatggtgcaacaggccgccgggggataa

DBGET integrated database retrieval system