KEGG   Sulfitobacter sp. JL08: C1J05_06545
Entry
C1J05_06545       CDS       T05585                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
suli  Sulfitobacter sp. JL08
Pathway
suli02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:suli00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C1J05_06545 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:suli02000]
    C1J05_06545 (phnC)
Enzymes [BR:suli01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     C1J05_06545 (phnC)
Transporters [BR:suli02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    C1J05_06545 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_22 AAA_16 RsgA_GTPase SMC_N AAA_PrkA Rad17 AAA_30 Mg_chelatase AAA_23 nSTAND1 AAA_25 AAA_33 MMR_HSR1 NB-ARC TsaE AAA_19 NACHT AAA_24
Other DBs
NCBI-ProteinID: AXI54196
LinkDB
Position
complement(1307199..1307999)
AA seq 266 aa
MLRLEKLVKTYKTGDQALKAVDLDVPEGQVLALIGPSGAGKSTLIRCINRLVEPTSGNVY
LDDVELTGLSAGALRRERRRMGMIFQEYALVERLTVMENVLSGRLGYVGFWRSFLRRYPQ
ADVDEAFRLLDRVGLAHMADKRADELSGGQRQRVGICRALIQNPALLLVDEPTASLDPKT
SRQIMRLICELCKERGLAAIINIHDVALAQMFVQRVIGLRVGAVEFDGPPEGLTPDVLTT
IYGEENWEATIEKVEDEEGIEEKVEV
NT seq 801 nt   +upstreamnt  +downstreamnt
atgctgcggcttgagaagcttgtaaagacttataaaactggcgatcaggccctgaaagcc
gttgatctggacgttcccgaaggtcaggttctggcattgatcggtccatccggcgccggt
aaatcaacgctgatccgctgcatcaatcggttggtcgaaccgacctcgggcaatgtttat
ctggacgatgtggaactgaccggattgtcggcaggtgcgttgcgccgcgaacgccgccgc
atggggatgatctttcaggaatacgcactggttgaacggctgaccgtgatggaaaacgtg
ttgtcgggccggttgggctatgtcgggttctggcgcagcttcctgcgccgttatccgcaa
gcagatgtcgacgaagcctttcgcctgctggatcgtgtcgggctggcccatatggcggat
aaacgtgccgacgaactgtcgggcggacagcgccagcgtgtcggtatctgccgcgcgctg
atccagaaccccgccctgttgctggtggatgaaccgaccgcgtcacttgatcccaagaca
tcgcgccagatcatgcgtctgatctgtgaactgtgcaaggaacgcggcctggctgcgatc
atcaacattcacgatgtcgcgctggcgcagatgttcgtacaacgcgtgatcggcctgcgg
gttggcgcagtagagtttgacggcccgcccgaaggtctgacccccgatgttctgaccacg
atctacggcgaagaaaattgggaagcgaccatcgaaaaggtcgaggacgaggaaggtatc
gaagaaaaggttgaagtatga

DBGET integrated database retrieval system