Sulfitobacter sp. JL08: C1J05_08745 Help Entry C1J05_08745       CDS       T05585                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism suli  Sulfitobacter sp. JL08 Pathway suli01100   Metabolic pathways suli01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:suli00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C1J05_08745    00074 Mycolic acid biosynthesis     C1J05_08745   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C1J05_08745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AXI54568 UniProt:  A0A345RAI1 LinkDB All DBs Position 1760215..1760448 Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVAENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFITEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgttgcagaccgcgttaaaaaaatcgttgtagaacaccttggtgtcgaggaa gacaaagtggcggaaaacgcttctttcatcgacgatctgggcgcagacagcttggacacc gtggaattggtgatggcgtttgaagaagagtttggcattgagatcccggatgatgcagcc gaaaccattcaaacctttggcgatgcagtgaagttcattactgaagcttcctga

DBGET integrated database retrieval system