Sulfitobacter sp. JL08: C1J05_19840 Help Entry C1J05_19840       CDS       T05585                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism suli  Sulfitobacter sp. JL08 Brite KEGG Orthology (KO) [BR:suli00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:suli03032]     C1J05_19840    03036 Chromosome and associated proteins [BR:suli03036]     C1J05_19840    03400 DNA repair and recombination proteins [BR:suli03400]     C1J05_19840 DNA replication proteins [BR:suli03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C1J05_19840 Chromosome and associated proteins [BR:suli03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C1J05_19840 DNA repair and recombination proteins [BR:suli03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C1J05_19840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_2 DUF2267 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AXI56457 UniProt:  A0A345RFX0 LinkDB All DBs Position complement(4046915..4047202) Genome browser AA seq 95 aa AA seqDB search MAKPMTKTQLVAALADEMGTDKKAAAGALDSVCALITREVSGGGAVTLPGVGKIYCRERP ERMVRNPATGEQFKKDADKVVKMTIAKALKDSVNG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcgaaaccaatgaccaaaacccaactcgtcgccgcactggccgatgaaatgggaaca gacaaaaaagcagcagcaggtgcgctggattcagtgtgtgcgctgatcacacgcgaagtt tccggcggcggcgccgtaacattgcccggcgttggcaaaatctattgccgcgaacggccc gagcgcatggtgcgcaacccggccacaggtgaacagttcaagaaagacgcggacaaagtc gtcaagatgacgattgccaaagcgttgaaagacagcgttaacggctga

DBGET integrated database retrieval system