Sulfurospirillum diekertiae JPD-1: SJPD1_2607 Help Entry SJPD1_2607        CDS       T05109                                  Name (GenBank) hot_dog super family protein   KO K02372   3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59] Organism sulj  Sulfurospirillum diekertiae JPD-1 Pathway sulj00061   Fatty acid biosynthesis sulj00780   Biotin metabolism sulj01100   Metabolic pathways sulj01212   Fatty acid metabolism sulj01240   Biosynthesis of cofactors Module sulj_M00083   Fatty acid biosynthesis, elongation Brite KEGG Orthology (KO) [BR:sulj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SJPD1_2607   09108 Metabolism of cofactors and vitamins    00780 Biotin metabolism     SJPD1_2607  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sulj01004]     SJPD1_2607 Enzymes [BR:sulj01000]  4. Lyases   4.2  Carbon-oxygen lyases    4.2.1  Hydro-lyases     4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase      SJPD1_2607 Lipid biosynthesis proteins [BR:sulj01004]  Fatty acid synthase   Component type    SJPD1_2607 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FabA PKS_DH_N Motif Other DBs NCBI-ProteinID:  ATB70701 UniProt:  A0A290HHK2 LinkDB All DBs Position 2520581..2520895 Genome browser AA seq 104 aa AA seqDB search MILNHLYTLTCKEGARFCVRLSDASHPIFQAHFPTNPILPGFILLDLSAEILGIEIVKIQ KAKFLKNITPLSVLWFDTQTHEKTLKIRVTQNEQKVAELTYEKR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgatactcaaccatttatatacgcttacatgtaaagaaggggcacgcttttgtgtgaga ctcagcgatgcgtcacatcccatttttcaagcgcattttcctacaaatcctattcttcct gggtttattttacttgatttaagcgcagaaattttgggaattgaaattgtaaaaattcaa aaagcaaaatttttaaaaaatattacgcctcttagtgtgctttggttcgacacgcaaacg catgaaaaaacactcaaaattcgtgtcacacaaaatgaacaaaaagtagcagaacttacg tatgaaaaaagatga

DBGET integrated database retrieval system