Sulfolobus sp. S-194: EWF20_03005 Help Entry EWF20_03005       CDS       T07725                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sull  Sulfolobus sp. S-194 Pathway sull03010   Ribosome Brite KEGG Orthology (KO) [BR:sull00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     EWF20_03005   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     EWF20_03005  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sull03011]     EWF20_03005    04121 Ubiquitin system [BR:sull04121]     EWF20_03005   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sull04147]     EWF20_03005 Ribosome [BR:sull03011]  Ribosomal proteins   Eukaryotes    Small subunit     EWF20_03005   Archaea     EWF20_03005 Ubiquitin system [BR:sull04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    EWF20_03005 Exosome [BR:sull04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    EWF20_03005   Exosomal proteins of colorectal cancer cells    EWF20_03005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_ribbon_SprT Cas12f1-like_TNB Zn_ribbon_RPB9 TackOD1 Zn_ribbon_Nudix YPEH2ZP EDR4-like_1st DUF5795 Zn_Ribbon_1 Phage_zn_bind_2 YhfH DUF1451 Zn_ribbon_PriA FlhC zf-tcix Zn_ribbon_3 DZR Motif Other DBs NCBI-ProteinID:  QIW23211 LinkDB All DBs Position 619885..620076 Genome browser AA seq 63 aa AA seqDB search MPKNKDESQKAIVRTYYIIEGDKIKLKNKKCPRCGSIMAHHMKPVERWACGKCGYTEFIG KGK NT seq 192 nt NT seq  +upstreamnt  +downstreamnt gtgcccaaaaacaaggatgaaagtcaaaaagctatagttaggacatactatataatagaa ggagataagattaaacttaaaaataaaaaatgtcctagatgcggtagtattatggcccat catatgaagcctgttgagcgctgggcttgtgggaaatgtggatatactgagtttataggt aaagggaaatga

DBGET integrated database retrieval system