Sulfolobus sp. E11-6: GFS33_01220 Help Entry GFS33_01220       CDS       T07647                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sulo  Sulfolobus sp. E11-6 Pathway sulo03010   Ribosome Brite KEGG Orthology (KO) [BR:sulo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     GFS33_01220   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     GFS33_01220  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sulo03011]     GFS33_01220    04121 Ubiquitin system [BR:sulo04121]     GFS33_01220   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sulo04147]     GFS33_01220 Ribosome [BR:sulo03011]  Ribosomal proteins   Eukaryotes    Small subunit     GFS33_01220   Archaea     GFS33_01220 Ubiquitin system [BR:sulo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    GFS33_01220 Exosome [BR:sulo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GFS33_01220   Exosomal proteins of colorectal cancer cells    GFS33_01220 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_ribbon_SprT Cas12f1-like_TNB YPEH2ZP UPF0179 Zn_ribbon_RPB9 Zn_ribbon_PriA Zn_ribbon_Nudix DUF5795 Zn_Ribbon_1 Lar_restr_allev DUF7838 YhfH FlhC ComFA_N Zn_ribbon_13 zf-tcix Zn_ribbon_3 DUF1451 DUF6758 Zn_ribbon_ACC Motif Other DBs NCBI-ProteinID:  QGA67619 LinkDB All DBs Position 200864..201055 Genome browser AA seq 63 aa AA seqDB search MAKEQKVKAIVRTYYVIEGNKIKLKNKKCPRCGSIMAHHLKPNERWSCGKCGYTEFIGTS KKR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt gtggccaaggagcaaaaggttaaagcaatagtaagaacttattatgtaatagaagggaat aagattaagctaaaaaataagaaatgccctaggtgcggaagtataatggctcatcactta aaaccaaatgagagatggtcttgtggaaagtgtggttacactgagtttataggcacttca aagaaaagataa

DBGET integrated database retrieval system