Candidatus Sulfuricurvum sp. RIFRC-1: B649_01650 Help Entry B649_01650        CDS       T02537                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sulr  Candidatus Sulfuricurvum sp. RIFRC-1 Pathway sulr01100   Metabolic pathways sulr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sulr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B649_01650    00074 Mycolic acid biosynthesis     B649_01650   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B649_01650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N DUF5783 PRD Motif Other DBs NCBI-ProteinID:  AFV96644 LinkDB All DBs Position 329711..329941 Genome browser AA seq 76 aa AA seqDB search MALIDDIKEVVVEQLSVNPDEVKEDSKFVEDLGADSLDVVELVMALEEKFDIEIPDDEAE KIQTVQDVINYIQSKN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcacttatcgacgatattaaagaagtagtggttgagcaactcagcgtaaacccggac gaagttaaagaggattctaaattcgtagaagatcttggcgctgacagccttgacgttgtt gaattggtaatggctcttgaagagaaattcgatatcgaaatccctgatgacgaagcggaa aaaatccaaactgttcaagatgtcatcaactacatccaaagcaaaaactaa

DBGET integrated database retrieval system