Sulfitobacter sp. SK012: C1J03_14110 Help Entry C1J03_14110       CDS       T05563                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sulz  Sulfitobacter sp. SK012 Pathway sulz01100   Metabolic pathways sulz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sulz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C1J03_14110    00074 Mycolic acid biosynthesis     C1J03_14110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C1J03_14110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AXI48912 LinkDB All DBs Position complement(2891522..2891755) Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVIENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ENIQTFGDAVKFIKEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgcagaccgcgtgaaaaagatcgttgtagagcaccttggtgttgaagag gacaaagttatcgagaacgcttcgttcatcgatgatctgggcgcagacagcctcgacacg gtcgagcttgtgatggcgttcgaagaagagttcggcatcgaaattcctgatgacgccgcc gaaaacatccagacttttggcgatgcggtaaagtttatcaaagaagcctcttaa

DBGET integrated database retrieval system