Sulfurovum sp. NBC37-1: SUN_0139 Help Entry SUN_0139          CDS       T00572                                  Name (GenBank) GTP cyclohydrolase I   KO K09457   7-cyano-7-deazaguanine reductase [EC:1.7.1.13] Organism sun  Sulfurovum sp. NBC37-1 Pathway sun00790   Folate biosynthesis sun01100   Metabolic pathways Module sun_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:sun00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SUN_0139  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:sun03016]     SUN_0139 Enzymes [BR:sun01000]  1. Oxidoreductases   1.7  Acting on other nitrogenous compounds as donors    1.7.1  With NAD+ or NADP+ as acceptor     1.7.1.13  preQ1 synthase      SUN_0139 Transfer RNA biogenesis [BR:sun03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     SUN_0139 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  QueF QueF_N GTP_cyclohydroI T7SS_EccA1_N Motif Other DBs NCBI-ProteinID:  BAF71099 UniProt:  A6Q6J0 LinkDB All DBs Position complement(141111..141488) Genome browser AA seq 125 aa AA seqDB search MKYGEKEIQEFDINAEENFWPNEHEKNYTINIELPEFMCLCPRSGYPDFAIMKLSYVPDK KVIELKALKLYINSFMYRHISHENSANEIFDALYSQLEPKSMKLIADFNPRGNVHTVIEI DSETF NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgaaatacggagaaaaagagatacaggaattcgacatcaatgccgaagagaatttctgg ccaaacgaacacgaaaagaattacactatcaacatagagctccctgagtttatgtgtctc tgtccacgctcgggttacccagacttcgcaataatgaaactttcatatgttcctgacaaa aaagtcattgagctcaaagcactcaaactctacatcaactcattcatgtacagacacatc tcccatgagaactccgccaatgagatttttgatgcactctatagccagctggaaccaaag tcaatgaaactcattgccgattttaatcccagaggaaatgtacacacagttatagagata gacagcgagacgttttaa

DBGET integrated database retrieval system