Sulfurovum sp. NBC37-1: SUN_0969 Help Entry SUN_0969          CDS       T00572                                  Name (GenBank) acyl carrier protein ACP   KO K02078   acyl carrier protein Organism sun  Sulfurovum sp. NBC37-1 Pathway sun01100   Metabolic pathways sun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SUN_0969    00074 Mycolic acid biosynthesis     SUN_0969   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SUN_0969 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BAF71926 UniProt:  A6Q8W7 LinkDB All DBs Position 989175..989423 Genome browser AA seq 82 aa AA seqDB search MTKDEIKKKIIEEIYEIAPEHEGETIPENENIQRSLEIDSFDFLNLLTALNDELGVEVPE SDYGEVDTVEHMADYFVKHLSK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacgaaagatgagattaaaaagaagataatcgaggagatctacgagatcgctccggaa cacgagggggagacgatccccgagaatgagaatattcagcgatcgcttgagatagactcg ttcgatttcctgaatttgttgaccgcacttaacgatgaacttggtgtggaagtacccgag tccgattacggagaggtcgatacggttgagcatatggctgactattttgtcaagcattta tcgaagtaa

DBGET integrated database retrieval system