Sceloporus undulatus (fence lizard): 121918950 Help Entry 121918950         CDS       T07740                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism sund  Sceloporus undulatus (fence lizard) Pathway sund04010   MAPK signaling pathway sund04068   FoxO signaling pathway sund04081   Hormone signaling sund04114   Oocyte meiosis sund04140   Autophagy - animal sund04150   mTOR signaling pathway sund04810   Regulation of actin cytoskeleton sund04910   Insulin signaling pathway sund04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:sund00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121918950 (INS)    04068 FoxO signaling pathway     121918950 (INS)    04150 mTOR signaling pathway     121918950 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     121918950 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121918950 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     121918950 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121918950 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     121918950 (INS)    04914 Progesterone-mediated oocyte maturation     121918950 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sund04052]     121918950 (INS) Cytokines and neuropeptides [BR:sund04052]  Neuropeptides   Unclassified    121918950 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  121918950 NCBI-ProteinID:  XP_042300965 LinkDB All DBs Position 1:complement(268781058..268785641) Genome browser AA seq 107 aa AA seqDB search MTLWISSLPLLVLIAVSAPTISRAIPNQHLCGSHLVEALYLVCGERGFYYSPKTRRNIEQ PLVNGPLQNEVETLPFQPQEFQKMKRGIVQQCCENTCSLYELENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgactctctggatcagttctttgcctctccttgttttgattgctgtttcagctcctacc attagtcgtgctattcccaatcagcatctatgtggctctcatctagtggaggccctctac ctggtatgtggagaacgaggcttctactattctcccaaaacacgacggaacatcgaacag cccctagtgaacgggcctttacagaatgaggtagaaacactgccattccaaccacaggaa tttcagaagatgaaaagaggaattgtgcagcaatgctgtgaaaatacctgctccctctat gagctggagaactactgcaactag

DBGET integrated database retrieval system