Sceloporus undulatus (fence lizard): 121921656 Help Entry 121921656         CDS       T07740                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism sund  Sceloporus undulatus (fence lizard) Pathway sund04010   MAPK signaling pathway sund04020   Calcium signaling pathway sund04114   Oocyte meiosis sund04218   Cellular senescence sund04310   Wnt signaling pathway sund04370   VEGF signaling pathway sund04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:sund00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121921656 (PPP3R1)    04310 Wnt signaling pathway     121921656 (PPP3R1)    04370 VEGF signaling pathway     121921656 (PPP3R1)    04020 Calcium signaling pathway     121921656 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     121921656 (PPP3R1)    04218 Cellular senescence     121921656 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121921656 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sund01009]     121921656 (PPP3R1) Protein phosphatases and associated proteins [BR:sund01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121921656 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  121921656 NCBI-ProteinID:  XP_042305950 LinkDB All DBs Position 1:complement(179459325..179469083) Genome browser AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcacactttgacgcagatgagattaaacgattgggaaagaggtttaaaaagctt gatttagataactccggttccttgagtgtggaagagttcatgtctttgcctgagttgcaa cagaatccattggtgcagcgagtaatagatatatttgatacagatggaaatggagaagta gacttcaaagaatttatagaaggagtctcccaattcagtgtcaaaggcgacaaggaacag aagttaaggtttgcttttcgtatctatgatatggacaaagatggctatatctccaatggg gagctcttccaggttctgaagatgatggttgggaacaatctcaaagatactcaattgcag caaatcgtagacaaaaccataataaatgcagataaagatggtgatggaagaatatccttt gaggaattctgtgctgttgtaggaggcctagatatccacaaaaagatggtggtagatgtg tga

DBGET integrated database retrieval system