Sceloporus undulatus (fence lizard): 121922071 Help Entry 121922071         CDS       T07740                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism sund  Sceloporus undulatus (fence lizard) Pathway sund04137   Mitophagy - animal sund04140   Autophagy - animal sund04144   Endocytosis sund04145   Phagosome sund04148   Efferocytosis sund05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sund00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121922071 (RAB7A)    04145 Phagosome     121922071 (RAB7A)    04140 Autophagy - animal     121922071 (RAB7A)    04137 Mitophagy - animal     121922071 (RAB7A)    04148 Efferocytosis     121922071 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121922071 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sund04131]     121922071 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sund04147]     121922071 (RAB7A)    04031 GTP-binding proteins [BR:sund04031]     121922071 (RAB7A) Membrane trafficking [BR:sund04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     121922071 (RAB7A) Exosome [BR:sund04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121922071 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    121922071 (RAB7A)   Exosomal proteins of colorectal cancer cells    121922071 (RAB7A)   Exosomal proteins of bladder cancer cells    121922071 (RAB7A) GTP-binding proteins [BR:sund04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     121922071 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  121922071 NCBI-ProteinID:  XP_042306919 LinkDB All DBs Position 2:55802406..55838096 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctagaaagaaagtattactcaaagtcatcatccttggagattcaggggtggga aagacatctcttatgaaccaatatgtgaacaagaaattcagtaaccagtacaaagctaca ataggagctgacttcctgacaaaagaggtgatggtggatgataggctagtcacaatgcag atatgggatacagcaggacaggaacggtttcagtccctgggagttgctttctatcgagga gcagactgctgtgtgctggtatttgacgtaacagctcccaacacattcaaaactcttgac agctggcgagatgagttcctgattcaagccagtccacgagatcctgagaactttcctttt gttgtgttgggaaacaagattgacctagaaaacagacaagttactacaaaacgagcacag gcctggtgctacagcaaaaacaatatcccttactttgaaaccagtgccaaggaggccatt aacgtggaacaggctttccagacaattgcacgaaatgcacttaaacaggaaactgaagtg gagctttacaatgaatttcctgaacctatcaaactagataagaatgaccgagcaaaggcc tctgcggagagctgcagctgctga

DBGET integrated database retrieval system