Sceloporus undulatus (fence lizard): 121922091 Help Entry 121922091         CDS       T07740                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism sund  Sceloporus undulatus (fence lizard) Pathway sund04068   FoxO signaling pathway sund04136   Autophagy - other sund04140   Autophagy - animal sund04621   NOD-like receptor signaling pathway sund04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:sund00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     121922091 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121922091 (ATG12)    04136 Autophagy - other     121922091 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121922091 (ATG12)    04622 RIG-I-like receptor signaling pathway     121922091 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sund04131]     121922091 (ATG12)    04121 Ubiquitin system [BR:sund04121]     121922091 (ATG12)    03029 Mitochondrial biogenesis [BR:sund03029]     121922091 (ATG12) Membrane trafficking [BR:sund04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     121922091 (ATG12) Ubiquitin system [BR:sund04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    121922091 (ATG12) Mitochondrial biogenesis [BR:sund03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     121922091 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  121922091 NCBI-ProteinID:  XP_042306962 LinkDB All DBs Position 2:267187995..267194440 Genome browser AA seq 149 aa AA seqDB search MSEGGGLREAAEDGGRGEGCGGGEESPPEGGAAALAMEEAVVAAPPGPLSPGNEEPAGDA RKKIDVLLKAVGDTPIMKTKKWTVERTRTIQGLIDFIKKFLKLLASEQLFIYVNQSFAPS PDQEVGTLYECFGSDGKLVLHYCKSQAWG NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgtccgagggaggagggttgcgagaggcggctgaggatggagggcgaggggaaggctgt ggcggcggggaagagagccctccggagggcggagcggcggcgctagcgatggaggaagcg gtagtggcggctcccccgggccctctttcccccggcaacgaggaaccggccggggacgcc aggaagaaaattgatgttttactcaaggctgttggagatactcctataatgaagacaaaa aaatggacagtagagagaactcgcacaatccaaggcctcattgactttatcaaaaagttt ctcaaacttttggcatcagaacagctgtttatttatgtgaatcagtcttttgctccttca ccggaccaggaggttggaacactatatgagtgttttggaagtgatgggaaacttgtgctg cattattgtaaatctcaagcctggggatga

DBGET integrated database retrieval system