Sceloporus undulatus (fence lizard): 121928242
Help
Entry
121928242 CDS
T07740
Symbol
ARFRP1
Name
(RefSeq) ADP-ribosylation factor-related protein 1
KO
K07952
ADP-ribosylation factor related protein 1
Organism
sund
Sceloporus undulatus (fence lizard)
Brite
KEGG Orthology (KO) [BR:
sund00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
sund04131
]
121928242 (ARFRP1)
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:
sund04031
]
121928242 (ARFRP1)
Membrane trafficking [BR:
sund04131
]
Endosome - Golgi transport
Arf GTPases and associated proteins
Arf GTPases
121928242 (ARFRP1)
GTP-binding proteins [BR:
sund04031
]
Small (monomeric) G-proteins
Arf/Sar Family
Arp
121928242 (ARFRP1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Arf
Ras
Roc
G-alpha
SRPRB
MMR_HSR1
Gtr1_RagA
GTP_EFTU
ATP_bind_1
DO-GTPase1
AAA_18
Motif
Other DBs
NCBI-GeneID:
121928242
NCBI-ProteinID:
XP_042318608
LinkDB
All DBs
Position
4:complement(6875566..6917424)
Genome browser
AA seq
201 aa
AA seq
DB search
MYTLLSGLYKYMFRRDEYCILILGLDNAGKTTFLEQTKTRFNRNYKGMSLSKITTTVGLN
IGTIDVGKARLMFWDLGGQEELQSLWDKYYAESHGVIYIIDSTDEERLQESKRAFEKMVT
SEVLEGVPLLVLANKQDVENCLSIPDIKTAFSDCINKIGKRDCLTQACSALTGKGVNEGI
EWMVKCVVRNIHRPPRQKDIT
NT seq
606 nt
NT seq
+upstream
nt +downstream
nt
atgtataccctgctgtctgggctttacaagtatatgttccggcgggatgagtattgcatc
ttgatacttggactagacaatgctgggaaaacgaccttccttgaacagactaaaacaaga
tttaacagaaattacaaaggaatgagcttatccaaaatcacaaccactgtgggcttgaac
attggcacaatagatgtgggcaaggccaggctaatgttctgggatcttggaggacaggaa
gaacttcagtctctctgggataagtattatgcagaatcccatggtgtcatctatattatt
gactctactgatgaagaacggcttcaggaatctaagcgagcgtttgaaaagatggttacc
agtgaagttctggaaggtgttccattattggttttggctaacaaacaagatgtagagaac
tgcctgtcaatcccggacatcaagactgcctttagcgactgcatcaacaaaattgggaag
agagactgtctgacgcaagcttgctctgctctcactggcaaaggggtaaatgaagggatt
gagtggatggtgaagtgcgtggtgaggaatatccatcggcccccgaggcagaaggacatc
acgtag
DBGET
integrated database retrieval system