Sceloporus undulatus (fence lizard): 121929449 Help Entry 121929449         CDS       T07740                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism sund  Sceloporus undulatus (fence lizard) Pathway sund04010   MAPK signaling pathway sund04012   ErbB signaling pathway sund04068   FoxO signaling pathway sund04137   Mitophagy - animal sund04140   Autophagy - animal sund04150   mTOR signaling pathway sund04210   Apoptosis sund04218   Cellular senescence sund04370   VEGF signaling pathway sund04371   Apelin signaling pathway sund04540   Gap junction sund04625   C-type lectin receptor signaling pathway sund04810   Regulation of actin cytoskeleton sund04910   Insulin signaling pathway sund04912   GnRH signaling pathway sund04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sund00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121929449 (NRAS)    04012 ErbB signaling pathway     121929449 (NRAS)    04370 VEGF signaling pathway     121929449 (NRAS)    04371 Apelin signaling pathway     121929449 (NRAS)    04068 FoxO signaling pathway     121929449 (NRAS)    04150 mTOR signaling pathway     121929449 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121929449 (NRAS)    04137 Mitophagy - animal     121929449 (NRAS)   09143 Cell growth and death    04210 Apoptosis     121929449 (NRAS)    04218 Cellular senescence     121929449 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     121929449 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121929449 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121929449 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     121929449 (NRAS)    04912 GnRH signaling pathway     121929449 (NRAS)    04916 Melanogenesis     121929449 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sund04131]     121929449 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sund04147]     121929449 (NRAS)    04031 GTP-binding proteins [BR:sund04031]     121929449 (NRAS) Membrane trafficking [BR:sund04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     121929449 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     121929449 (NRAS) Exosome [BR:sund04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121929449 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    121929449 (NRAS)   Exosomal proteins of breast cancer cells    121929449 (NRAS)   Exosomal proteins of colorectal cancer cells    121929449 (NRAS) GTP-binding proteins [BR:sund04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121929449 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  121929449 NCBI-ProteinID:  XP_042320958 LinkDB All DBs Position 4:48101446..48110936 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSEDVPMVLVGNKCDL PTRTVDTKQAHEVAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKRLNSSEDGNQG CMGLSCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatacaagctagtagtggtgggtgctggtggtgttgggaaaagtgccctgacc attcagcttatccagaatcactttgttgatgaatatgatcccactatagaggactcttat cgtaagcaagtagtgattgatggagagacttgtttgctagacattctggatacagcagga caggaggaatatagtgccatgagggaccaatatatgagaactggcgaaggttttctctgt gtgtttgccattaacaacagcaaatcctttgcagatatcaatctttacagagagcagata aagagagtgaaagattctgaagatgtaccaatggtgttagtgggaaacaaatgtgacttg ccaacacgaacagtagataccaaacaggcccatgaagtagccaagagctatgggattccc ttcattgaaacatctgccaaaacaagacagggtgttgaagatgccttttatacactggtg agggagatccgtcaatatcggatgaaaagactcaacagcagtgaagatgggaatcaaggc tgtatggggctgtcatgcgttgtgatgtga

DBGET integrated database retrieval system