Sceloporus undulatus (fence lizard): 121930826 Help Entry 121930826         CDS       T07740                                  Name (RefSeq) C-type lectin-like   KO K22244   regenerating islet-derived protein 4 Organism sund  Sceloporus undulatus (fence lizard) Brite KEGG Orthology (KO) [BR:sund00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:sund01002]     121930826   09183 Protein families: signaling and cellular processes    04091 Lectins [BR:sund04091]     121930826 Peptidases and inhibitors [BR:sund01002]  Peptidase inhibitors   Family I63    121930826 Lectins [BR:sund04091]  C-Type lectins   Others    121930826 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  121930826 NCBI-ProteinID:  XP_042323661 LinkDB All DBs Position 5:2642882..2647101 Genome browser AA seq 91 aa AA seqDB search MRVVAQYVLRNYKGNKYVWIGLYDTKKGKAGRNREFKWTDGSKGRYMPWAPGEPNLGIGN EFCVELYANDFMEWNDGDCERKQPYLCKLTP NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagggtagtggcccaatatgttttgcgcaattataaaggcaataaatatgtctggata ggactgtatgacaccaagaaagggaaggcagggaggaaccgagagttcaaatggactgac ggatccaaaggccggtatatgccctgggccccaggggaacccaatcttggcattggcaac gagttctgtgtggagctgtacgcaaatgactttatggaatggaacgatggtgactgtgaa agaaagcaaccctacctgtgtaagttgacaccctga

DBGET integrated database retrieval system