KEGG Orthology (KO) [BR:sund00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04120 Ubiquitin mediated proteolysis
121933039 (ELOB)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04121 Ubiquitin system [BR:sund04121]
121933039 (ELOB)
03400 DNA repair and recombination proteins [BR:sund03400]
121933039 (ELOB)
Ubiquitin system [BR:sund04121]
Ubiquitin ligases (E3)
Multi subunit type E3
Cul2 complex
Adoptor protein
121933039 (ELOB)
Cul5 complex
121933039 (ELOB)
DNA repair and recombination proteins [BR:sund03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
Other NER factors
121933039 (ELOB)
159 aa
MRGGGGCFPRKPGVAVHAGIQGVLLLFPLWGLWAEAAAAEMDVFLMIRRHKTTIFTDAKE
SSTVYELKRIVEGILKRPPEEQRLYKEDQLLDDTKTLGDCGFTSQTARPQAPATVGLAFR
ASEDAFEPLRIDSFSSPPELPDVMKPQDSSSSANEQAVQ