Sceloporus undulatus (fence lizard): 121935514 Help Entry 121935514         CDS       T07740                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism sund  Sceloporus undulatus (fence lizard) Pathway sund04010   MAPK signaling pathway sund04137   Mitophagy - animal sund04140   Autophagy - animal sund04218   Cellular senescence sund04371   Apelin signaling pathway sund04519   Cadherin signaling sund04625   C-type lectin receptor signaling pathway sund04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:sund00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121935514 (RRAS)    04371 Apelin signaling pathway     121935514 (RRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     121935514 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121935514 (RRAS)    04137 Mitophagy - animal     121935514 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     121935514 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121935514 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121935514 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sund04147]     121935514 (RRAS)    04031 GTP-binding proteins [BR:sund04031]     121935514 (RRAS) Exosome [BR:sund04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121935514 (RRAS)   Exosomal proteins of bladder cancer cells    121935514 (RRAS) GTP-binding proteins [BR:sund04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121935514 (RRAS) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 DUF6806 P-loop_TraG Motif Other DBs NCBI-GeneID:  121935514 NCBI-ProteinID:  XP_042333051 LinkDB All DBs Position 6:97447784..97464091 Genome browser AA seq 203 aa AA seqDB search MMNPSEGAAAQEKYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICNIDGTP TRLDILDTAGQEEFGAMREQYMRTGEGFLLVYAINDRGSFIEINKFHTQILRVKDRDEFP MILVGNKADLDLHRQVSKEEALSFARENRIPYMEASAKLRLNVDESFHELVRAIRRFHEL ESPPAPTVNPKKKESRGCPCSIL NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atgatgaatcccagcgagggtgcggctgcccaggagaaatacaagctggtggtggtcgga ggaggaggagtgggcaagagtgccctcaccatccagttcatccagtcatattttgtctct gactatgaccccacaattgaggactcatacacaaaaatctgcaacattgatggcacccca acgcggctggacatcctggacactgctgggcaggaggagtttggggccatgcgtgagcag tacatgcgtacaggggaaggttttctccttgtctatgccatcaacgaccgtggcagtttc attgagatcaacaagttccacactcagatacttagagtgaaagaccgtgatgagtttccc atgatccttgtgggcaacaaggctgacttggaccttcatcgacaggtgtccaaagaggag gccctcagttttgcccgggagaaccgaatcccatacatggaagcttctgccaaactccgt ctcaatgtggatgaatcgttccatgagctggtgagggccatcaggaggtttcatgagctg gagtctcccccagccccaactgttaaccctaagaagaaagaaagcagaggctgtccttgt tccattctgtaa

DBGET integrated database retrieval system