Sceloporus undulatus (fence lizard): 121935514 Help Entry 121935514         CDS       T07740                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism sund  Sceloporus undulatus (fence lizard) Pathway sund04010   MAPK signaling pathway sund04137   Mitophagy - animal sund04140   Autophagy - animal sund04218   Cellular senescence sund04371   Apelin signaling pathway sund04625   C-type lectin receptor signaling pathway sund04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:sund00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121935514 (RRAS)    04371 Apelin signaling pathway     121935514 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121935514 (RRAS)    04137 Mitophagy - animal     121935514 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     121935514 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121935514 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121935514 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sund04147]     121935514 (RRAS)    04031 GTP-binding proteins [BR:sund04031]     121935514 (RRAS) Exosome [BR:sund04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121935514 (RRAS)   Exosomal proteins of bladder cancer cells    121935514 (RRAS) GTP-binding proteins [BR:sund04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121935514 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 DUF6806 P-loop_TraG Motif Other DBs NCBI-GeneID:  121935514 NCBI-ProteinID:  XP_042333051 LinkDB All DBs Position 6:97447784..97464091 Genome browser AA seq 203 aa AA seqDB search MMNPSEGAAAQEKYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICNIDGTP TRLDILDTAGQEEFGAMREQYMRTGEGFLLVYAINDRGSFIEINKFHTQILRVKDRDEFP MILVGNKADLDLHRQVSKEEALSFARENRIPYMEASAKLRLNVDESFHELVRAIRRFHEL ESPPAPTVNPKKKESRGCPCSIL NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atgatgaatcccagcgagggtgcggctgcccaggagaaatacaagctggtggtggtcgga ggaggaggagtgggcaagagtgccctcaccatccagttcatccagtcatattttgtctct gactatgaccccacaattgaggactcatacacaaaaatctgcaacattgatggcacccca acgcggctggacatcctggacactgctgggcaggaggagtttggggccatgcgtgagcag tacatgcgtacaggggaaggttttctccttgtctatgccatcaacgaccgtggcagtttc attgagatcaacaagttccacactcagatacttagagtgaaagaccgtgatgagtttccc atgatccttgtgggcaacaaggctgacttggaccttcatcgacaggtgtccaaagaggag gccctcagttttgcccgggagaaccgaatcccatacatggaagcttctgccaaactccgt ctcaatgtggatgaatcgttccatgagctggtgagggccatcaggaggtttcatgagctg gagtctcccccagccccaactgttaaccctaagaagaaagaaagcagaggctgtccttgt tccattctgtaa

DBGET integrated database retrieval system