Sceloporus undulatus (fence lizard): 121936891 Help Entry 121936891         CDS       T07740                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism sund  Sceloporus undulatus (fence lizard) Pathway sund04020   Calcium signaling pathway sund04070   Phosphatidylinositol signaling system sund04114   Oocyte meiosis sund04218   Cellular senescence sund04261   Adrenergic signaling in cardiomyocytes sund04270   Vascular smooth muscle contraction sund04371   Apelin signaling pathway sund04625   C-type lectin receptor signaling pathway sund04744   Phototransduction sund04910   Insulin signaling pathway sund04912   GnRH signaling pathway sund04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sund00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     121936891 (CALML6)    04020 Calcium signaling pathway     121936891 (CALML6)    04070 Phosphatidylinositol signaling system     121936891 (CALML6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     121936891 (CALML6)    04218 Cellular senescence     121936891 (CALML6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121936891 (CALML6)   09152 Endocrine system    04910 Insulin signaling pathway     121936891 (CALML6)    04912 GnRH signaling pathway     121936891 (CALML6)    04916 Melanogenesis     121936891 (CALML6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     121936891 (CALML6)    04270 Vascular smooth muscle contraction     121936891 (CALML6)   09157 Sensory system    04744 Phototransduction     121936891 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sund01009]     121936891 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sund04131]     121936891 (CALML6)    03036 Chromosome and associated proteins [BR:sund03036]     121936891 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sund04147]     121936891 (CALML6) Protein phosphatases and associated proteins [BR:sund01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121936891 (CALML6) Membrane trafficking [BR:sund04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121936891 (CALML6) Chromosome and associated proteins [BR:sund03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121936891 (CALML6) Exosome [BR:sund04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121936891 (CALML6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_9 AIF-1 EF-hand_5 EH Motif Other DBs NCBI-GeneID:  121936891 NCBI-ProteinID:  XP_042335505 LinkDB All DBs Position 7:5908281..5915057 Genome browser AA seq 156 aa AA seqDB search MTQTLTAEQITEYKGIFEMFDEEGNGLVKTSELERLMSLIGINPTKRELVTMAKDVDKDN KGTFNCDGFLVLMGIYHEKAKNQDEELRAAFKVFDQEHKGYIEWNTLKYVLTNAGEPLDE HEAELMMKEADKDGDGTIDYEEFVAMMTGESFKLTQ NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgacccaaacgctaacagcagagcagatcacggagtacaaggggatctttgagatgttc gacgaagaggggaatggcttggtgaagacgtcagagctggagcggctcatgagtttgatc ggcatcaatcccaccaagagggaactggtgacgatggcaaaggacgtcgacaaagacaat aaaggcaccttcaactgcgacggattcctagttttgatggggatctaccacgaaaaagcc aaaaaccaggacgaagagctgagagcggccttcaaagtcttcgaccaagagcacaaaggt tacattgagtggaacacgctgaaatatgtgctgacaaacgctggagagccactggatgaa catgaagctgagctcatgatgaaagaagccgacaaggatggggacgggaccattgattat gaagaatttgtggcgatgatgaccggcgaatcttttaaactgacccaataa

DBGET integrated database retrieval system