Streptococcus suis S735 (serotype 2): YYK_00120 Help Entry YYK_00120         CDS       T02214                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sup  Streptococcus suis S735 (serotype 2) Pathway sup01100   Metabolic pathways sup01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sup00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     YYK_00120    00074 Mycolic acid biosynthesis     YYK_00120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     YYK_00120 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5578 DUF1493 Motif Other DBs NCBI-ProteinID:  AFQ99544 LinkDB All DBs Position 30346..30594 Genome browser AA seq 82 aa AA seqDB search MTREQVYQRVVELIQDEKGEDFQVQPESTLADNIAADSVEIMEFVLNLEDEFHVDVPDAA IEHFEVLSDIVDFIYKEVKKRS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactagagagcaggtctatcagcgggttgttgaattaattcaggatgaaaagggagaa gattttcaagttcaacctgaatctactttggcagataatattgcagcagattcagtagaa atcatggaatttgttcttaatttggaggatgaatttcatgtagatgtcccagatgctgct attgagcattttgaggttctatctgatattgttgattttatttataaagaagtaaaaaaa cgttcgtag

DBGET integrated database retrieval system