Superficieibacter sp. HKU1: P0H77_09460 Help Entry P0H77_09460       CDS       T08896                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism supe  Superficieibacter sp. HKU1 Pathway supe01100   Metabolic pathways supe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:supe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P0H77_09460 (acpP)    00074 Mycolic acid biosynthesis     P0H77_09460 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P0H77_09460 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  WES70177 LinkDB All DBs Position 1994151..1994387 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagttgggcgttaagcag gaagaagtgaccaacaatgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcactaccgttcaggctgccattgattatatcaacggccaccaggcgtaa

DBGET integrated database retrieval system