Superficieibacter sp. HKU1: P0H77_14590
Help
Entry
P0H77_14590 CDS
T08896
Name
(GenBank) SulP family inorganic anion transporter
KO
K03321
sulfate permease, SulP family
Organism
supe
Superficieibacter sp. HKU1
Brite
KEGG Orthology (KO) [BR:
supe00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
supe02000
]
P0H77_14590
Transporters [BR:
supe02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
P0H77_14590
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
MFS_MOT1
Motif
Other DBs
NCBI-ProteinID:
WES66870
LinkDB
All DBs
Position
3042724..3043971
Genome browser
AA seq
415 aa
AA seq
DB search
MSETQSSLSPARQGAIGSVIRSPSLLLRESLAGVITALALIPEVISFSVIAGVDPKVSLI
ASVVLCLAMSVLGGRPAMVTAAAGSVALVIGPMVHQHGVAYILPAVVLAGIIQIIFGLSG
MARLMRFIPQAVMTGFVNALGILIFFAQVPHFWSRSPLVIGLFVLTLLIVLWVPRFTKSI
PSPLIAIVLLTIFTITTGQLMPTVGDEGSMGGGMPGFSELLVPLDLHTLSIIWPCALSIA
FVGLMESLLTAKLVDDLTATASNKHRESTGLGIANILAGFYGGIAGCAMIGQTIVNVEMG
RARSRISTVAAGLVLLLLVTGLSEVMAKIPMAVLAGIMVIVAVKTFSWHSIRPATLKSAP
WPETVVMMITVAATVTTGNLAIGVLAGVITMAIMPHRIKRKYRLKAEKASPDQEK
NT seq
1248 nt
NT seq
+upstream
nt +downstream
nt
atgtctgaaactcaatcgtctttatcgcccgcccgtcagggtgcaattggcagcgtaata
cgctcgccgtcgctgctgctgcgcgaatcactggccggggtgatcaccgcgctggcgctg
atcccggaagtcatctctttctccgtcattgccggggttgacccgaaagtgagcctgatc
gcttcagtggtattatgcctggcgatgtcggtgctcggcgggcgtccggccatggttacc
gcagcggcaggttccgtggcactggtgatcgggccaatggttcaccagcacggcgtggcc
tatattctccccgccgtggtgctggccgggatcattcaaatcatttttggtctgagcggt
atggcacgtctgatgcgttttattccgcaggcggtaatgaccggctttgtaaacgcgctg
ggcattttgattttcttcgcccaggtgccgcacttctggagccgaagcccgctggtgatc
ggtctgtttgtgctgacgctattgattgtgctgtgggtgccgcgttttacgaaaagcatc
ccctccccgctcattgccattgtgctgttgacgatttttaccatcactaccggccagttg
atgcctacggtcggcgatgaagggtcgatgggcggcggaatgccgggctttagcgaactg
ctggtgccgctggatctccataccctgagtattatctggccgtgcgcgctaagcatcgcc
ttcgtgggattaatggaatccctgctgaccgcaaaactggtagacgacctgaccgcgacc
gcctcgaataaacatcgggaaagcaccggcctcggcatcgccaacattctggcaggcttt
tacggcggcatcgccgggtgtgcgatgattggacaaaccatcgttaacgtggagatgggc
cgcgcgcgcagccgcatttctaccgtggcagccggcctggtgcttctgctgctggtcacg
ggcttaagtgaggtgatggcgaaaatcccgatggccgtgctggccgggattatggttatc
gtggcggtaaaaacctttagctggcacagtatccgccccgccacgctaaaaagcgcaccg
tggccggaaaccgtggtgatgatgattaccgttgccgcgacggtgacaacggggaatctg
gcgattggcgtactggcaggcgttattaccatggccatcatgccgcaccgcattaagcga
aaataccggcttaaagcagaaaaagcgtcgccagaccaagaaaaataa
DBGET
integrated database retrieval system