KEGG   Stigmatella aurantiaca: STAUR_3136
Entry
STAUR_3136        CDS       T01425                                 
Symbol
valM
Name
(GenBank) Aminotransferase
  KO
K20435  validone 7-phosphate aminotransferase [EC:2.6.1.-]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00525  Acarbose and validamycin biosynthesis
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    STAUR_3136 (valM)
Enzymes [BR:sur01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     STAUR_3136 (valM)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: ADO70928
UniProt: Q08VU4
LinkDB
Position
complement(3776231..3777484)
AA seq 417 aa
MTVPPPFYYETGDIVLTEGAGVRVRTRDGREFLDCISGTFNLLLGHNHPEVMAAAKAQMD
RLVHTGSSYLSEPVEQLAAALVALAPSNLSRVHLRSSGGSTANEGAIRIAQHVTGKRDVI
TMFRSHLGQTMATIGYSGFSFHRAPFPYVMPGALHVPEPSCSRCFYGQTAEHCELPCVSR
IDDFIRYASSGSVACVMIEPIFGVGGNIVPPPRYFPELKRFCEERGIVLIFDEIQTGFGR
TGEMFAANYFGVSPHMMTLSKGLTGSGFPMGAILTEERLMGMPRIHHGFTGGGNAVAAAA
ALKTVEIVSRPGFLPHVRQVGTRLREGLARLAPDHPFIGEVRGVGLMLGLEVVGPRGEAA
PAKALGLQAALLRQGLMTRVSEHGRGHVIEIRPALVITEKEVDELLARFGEACHALA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaccgtcccgccccccttctattatgagaccggcgacatcgtcctgaccgagggcgcg
ggggtgagggtgcgcacccgggacggccgggagttcctcgactgcatctcgggcaccttc
aacctcctgctgggccacaaccacccggaggtgatggccgccgcgaaggcccagatggac
cggctggtgcacacgggctcctcttacctgtcagagcccgtcgagcagctcgccgcggcg
ctggtggccctggccccctcgaacctgtcgcgtgtgcacctgcgcagctcgggcggctcc
accgcgaacgagggcgccatccgcatcgcccagcacgtcacgggcaagcgggatgtcatc
acgatgttccggagccacctgggccaaaccatggccaccatcgggtactcgggcttctcg
tttcaccgggcccccttcccttatgtcatgccgggggcgttgcacgtcccagagccctcg
tgctcacggtgcttctacggccagacggcggagcactgcgagctgccttgcgtgtcccgg
atcgacgacttcatccgctacgccagctcgggcagcgtggcgtgcgtgatgatcgagccg
atcttcggggtcggcgggaacatcgtgcccccgccgcgctatttccccgagctcaagcgg
ttctgcgaagagcggggcatcgtcctcatcttcgacgagatccagacgggctttggccgc
acgggcgagatgttcgccgcgaactactttggcgtctccccccacatgatgaccctgtcc
aagggtctgacggggagcgggtttccgatgggggccatcctcaccgaggagcggctgatg
gggatgccgcgcatccaccacggcttcaccggcgggggcaacgccgtggcggcggcggcg
gcgctgaagacggtggagattgtctcgcgcccgggtttccttccccacgtccggcaggtg
ggaacgcgcctgcgcgaggggctggcccggctcgccccggaccaccccttcatcggagag
gtccggggggtgggactgatgctggggctggaggtggtggggccccggggagaggccgcc
cccgcgaaagcgctgggattgcaggcagccctgctgcgccagggattgatgacccgggtc
tccgagcatgggcgcggccacgtcatcgagatccgcccggcgctcgtcatcaccgagaaa
gaggtggatgagctcctcgcccgcttcggagaggcgtgccatgccctggcgtga

DBGET integrated database retrieval system