KEGG   Strix uralensis (Ural owl): 141938665
Entry
141938665         CDS       T11361                                 
Symbol
BCAP31
Name
(RefSeq) B-cell receptor-associated protein 31 isoform X1
  KO
K14009  B-cell receptor-associated protein 31
Organism
sura  Strix uralensis (Ural owl)
Pathway
sura04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sura00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    141938665 (BCAP31)
SSDB
Other DBs
NCBI-GeneID: 141938665
NCBI-ProteinID: XP_074713718
LinkDB
Position
Unknown
AA seq 242 aa
MSLQWTAVATFLYAEVFLVLLLCVPFVSAARWQKIFKSRLVGLAVAYGNTVFVVLIVILV
LLLFDALRETRKYDVTERVALQSSPGALEHFHMKLFRAQRNLYLAGFALLLSFLLRRLVT
LISQQAVLGASSEAFRKQAEGASQAARRYMEDNDALRKQLQEAGGDGGSPSPSQDENETL
KAKVEKLKEELAASKRTLEKAENEVQAMRRQAEGLTREYDRLLDQHARLQAAHDGPRDKK
EE
NT seq 729 nt   +upstreamnt  +downstreamnt
atgagcctgcagtggacggcggtcgccaccttcctctacgctgaagtattcctcgtcctt
ctgctctgtgtccccttcgtctcagctgccagatggcagaagatattcaagtcacgcctg
gtgggtctggccgtcgcctacggcaacaccgtcttcgtggtcctcatcgtcatcctcgtc
ctcctgctcttcgatgccctgcgggagacccgtaagtacgacgtgacagagcgggtggcc
ctgcagagcagccccggtgccctcgagcacttccacatgaagctcttccgggcccagcgc
aacctctacctggccggctttgccctcctgctctccttcctcctgcgccgcctggtcacc
ctcatctcgcagcaggccgtgctgggcgcctccagcgaggccttccggaaacaggcagag
ggtgccagccaggccgctcgccgctacatggaggacaatgacgccctgcggaagcagctg
caggaggcagggggtgatgggggcagcccgtccccctcccaggacgagaacgagaccctc
aaggccaaggtggagaagctgaaggaggagctggcggccagcaagcgcactctggagaag
gcagagaacgaggtgcaggccatgcgtcgccaggccgaggggctgacacgggagtacgac
cggctgctggaccagcatgcccgcctgcaggctgcccacgatggtccccgggacaagaag
gaggagtga

DBGET integrated database retrieval system