Strix uralensis (Ural owl): 141939227 Help Entry 141939227         CDS       T11361                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism sura  Strix uralensis (Ural owl) Pathway sura04814   Motor proteins sura05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sura00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     141939227 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141939227 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sura03037]     141939227 (DYNLT3)    04812 Cytoskeleton proteins [BR:sura04812]     141939227 (DYNLT3) Cilium and associated proteins [BR:sura03037]  Motile cilia and associated proteins   Dynein arm    141939227 (DYNLT3) Cytoskeleton proteins [BR:sura04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      141939227 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  141939227 NCBI-ProteinID:  XP_074714655 LinkDB All DBs Position 2:43383644..43392116 Genome browser AA seq 116 aa AA seqDB search MEEFHPHNDEMIFNADEAHNIVKECIESVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGK TYKYIVTCAVMQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtttcatccccacaacgacgagatgatcttcaatgctgatgaggcccacaac atagttaaggagtgcatagaaagcgttttaggcaaggcagattataatcacaacaaagtc aaccagtggactgctgctatagtagaacagtcgctgacacatctggtaaaactcggaaaa acatataagtacatcgtaacctgtgcagtgatgcagaggagtggagctggtcttcacaca gcaagctcgtgcttctgggataccacaactgatggaacctgcacagtgagatgggaaaac cgaacaatgaactgcattgtcaatgtgtttgctgttgctattatcctgtag

DBGET integrated database retrieval system