Strix uralensis (Ural owl): 141940922 Help Entry 141940922         CDS       T11361                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism sura  Strix uralensis (Ural owl) Pathway sura04814   Motor proteins sura05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sura00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     141940922 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141940922 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sura03037]     141940922 (DYNLT1)    04812 Cytoskeleton proteins [BR:sura04812]     141940922 (DYNLT1) Cilium and associated proteins [BR:sura03037]  Motile cilia and associated proteins   Dynein arm    141940922 (DYNLT1) Cytoskeleton proteins [BR:sura04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      141940922 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  141940922 NCBI-ProteinID:  XP_074718838 LinkDB All DBs Position 3:68940927..68946467 Genome browser AA seq 113 aa AA seqDB search MDDFQSGEETSFVVDEVSGIIKEAIESAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacttccagtcgggggaggagacttcctttgttgttgatgaagtcagtggcatc attaaagaggccatagaaagtgcgataggtggcaatgcctaccagcacagcaaagtgaac cagtggacaacaagtgtggtggaacaaacactgagccaactcacaaagctggggaagcct ttcaagtatattgtgacctgtgtgattatgcaaaagaatggtgctgggctacatacagca agctcttgcttctgggacaactccagtgatggaacctgcactgtgagatgggagaataag actatgtactgtattgtcagtgcctttggacttgcaatataa

DBGET integrated database retrieval system