Strix uralensis (Ural owl): 141947826 Help Entry 141947826         CDS       T11361                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism sura  Strix uralensis (Ural owl) Pathway sura04081   Hormone signaling sura04144   Endocytosis sura04150   mTOR signaling pathway sura04270   Vascular smooth muscle contraction sura04310   Wnt signaling pathway sura04350   TGF-beta signaling pathway sura04510   Focal adhesion sura04517   IgSF CAM signaling sura04519   Cadherin signaling sura04520   Adherens junction sura04530   Tight junction sura04621   NOD-like receptor signaling pathway sura04625   C-type lectin receptor signaling pathway sura04810   Regulation of actin cytoskeleton sura05100   Bacterial invasion of epithelial cells sura05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sura00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     141947826 (RHOA)    04350 TGF-beta signaling pathway     141947826 (RHOA)    04150 mTOR signaling pathway     141947826 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     141947826 (RHOA)    04517 IgSF CAM signaling     141947826 (RHOA)    04519 Cadherin signaling     141947826 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     141947826 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     141947826 (RHOA)    04520 Adherens junction     141947826 (RHOA)    04530 Tight junction     141947826 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     141947826 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     141947826 (RHOA)    04625 C-type lectin receptor signaling pathway     141947826 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     141947826 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141947826 (RHOA)    05100 Bacterial invasion of epithelial cells     141947826 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sura04131]     141947826 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sura04147]     141947826 (RHOA)    04031 GTP-binding proteins [BR:sura04031]     141947826 (RHOA) Membrane trafficking [BR:sura04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     141947826 (RHOA) Exosome [BR:sura04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141947826 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    141947826 (RHOA)   Exosomal proteins of colorectal cancer cells    141947826 (RHOA)   Exosomal proteins of bladder cancer cells    141947826 (RHOA) GTP-binding proteins [BR:sura04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     141947826 (RHOA) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  141947826 NCBI-ProteinID:  XP_074735494 LinkDB All DBs Position 10:complement(17229947..17256524) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aactatgtagcagatatcgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaaatggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcattcgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system