Strix uralensis (Ural owl): 141952876 Help Entry 141952876         CDS       T11361                                  Symbol URM1 Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism sura  Strix uralensis (Ural owl) Pathway sura04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:sura00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     141952876 (URM1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:sura03016]     141952876 (URM1)    04121 Ubiquitin system [BR:sura04121]     141952876 (URM1) Transfer RNA biogenesis [BR:sura03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     141952876 (URM1) Ubiquitin system [BR:sura04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    141952876 (URM1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  141952876 NCBI-ProteinID:  XP_074746994 LinkDB All DBs Position 21:complement(6332808..6350067) Genome browser AA seq 101 aa AA seqDB search MAAPVSLQVEFGGGAELLFDGVKKHQVTLPCQPEPWDIRNLLKWIKQNLLKERPELFMQG ESVRPGILVLINDADWELMGELDYKLQDQDNVLFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcggcgcccgtgtcgctgcaggtggagttcggaggtggtgcagaactcttgttcgat ggtgtcaaaaagcatcaggtgactttgccctgtcaaccagagccttgggatatcagaaac ctgctaaagtggatcaaacagaatctgttgaaagaacgaccagaattatttatgcaaggg gaatctgtgaggccaggaattttggtgctcatcaacgacgcggactgggaactaatgggt gagctggattataaactccaggaccaggataatgtgcttttcatctcgacattgcacggc gggtga

DBGET integrated database retrieval system