KEGG   Serratia ureilytica: J0X03_03185
Entry
J0X03_03185       CDS       T07185                                 
Symbol
mutY
Name
(GenBank) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
suri  Serratia ureilytica
Pathway
suri03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    J0X03_03185 (mutY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_03185 (mutY)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     J0X03_03185 (mutY)
DNA repair and recombination proteins [BR:suri03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     J0X03_03185 (mutY)
 Prokaryotic type
     J0X03_03185 (mutY)
SSDB
Motif
Pfam: HhH-GPD NUDIX_4 HHH EndIII_4Fe-2S
Other DBs
NCBI-ProteinID: QSR08010
LinkDB
Position
complement(693236..694336)
AA seq 366 aa
MMQAQQFAQVVLDWYQRYGRKTLPWQLEKTAYQVWLSEVMLQQTQVATVIPYFQRFMARF
PNVRALAEAPLDEVLHLWTGLGYYARARNLHKAAQTIVAQHGGEFPTTFAEIADLPGVGR
STAGAVLSLALGQHYPILDGNVKRVLARCYAVEGWPGKKEVENRLWKISEEVTPAQGVGQ
FNQAMMDLGAMVCTRSKPKCELCPLNVGCLSYANHSWANYPGKKPKQTLPEKTAYFLLLQ
HGDRVWLEQRPAVGLWGGLFCFPQFSARVDLELWLQQRGLKGKRLEQLTAFRHTFSHFHL
DIVPMWLSLDAAGSGMDEGAGLWYNLAQPPSVGLAAPVDRLLQQLAKQPPIQQNLYGDSA
IDEELA
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgatgcaagcacaacaattcgcacaggtggtgcttgactggtaccagcgctacggccgc
aaaaccctgccatggcagctggagaaaaccgcctatcaagtatggctctccgaagtgatg
ttgcaacagacccaggttgccaccgtcattccttattttcagcgctttatggcccgtttt
cccaacgtgcgcgcgctggcggaggccccgctggacgaagtgctgcatctgtggaccggc
ctcggctattacgcccgcgcccgtaacctgcacaaagcggcgcagaccattgtcgcacag
cacggcggcgagttcccgacaaccttcgcagaaatcgccgatttaccgggcgtcggccgt
tccaccgccggcgcggtgctgtcgttggcgctgggccaacactatccgatcctcgacggc
aacgtgaagcgcgtgctggctcgctgctacgcggtggaaggctggccgggcaaaaaagag
gtcgaaaaccggctgtggaaaatcagcgaagaagtcaccccggcccagggcgtcggccag
ttcaaccaggcgatgatggatctgggcgccatggtctgcacccgctccaagcccaagtgt
gagctctgcccgctcaacgtcggctgcctgtcttacgccaaccacagctgggccaactac
cccggcaagaagcccaagcagaccctgccggaaaaaaccgcctacttcttattgctgcaa
cacggcgaccgcgtgtggctggagcagcgcccggcggtaggcctgtggggcggcctgttc
tgcttcccgcagttcagcgcgcgcgtggatttggaactctggctgcagcagcgcggtctg
aaaggcaagcgcctggaacagctgaccgcgtttcgccacacgttcagccatttccatctc
gatatcgtgccgatgtggctgtcgctcgacgcggcgggcagcggcatggatgagggcgcg
ggtctctggtataacttagcgcagccgccgtcggtcgggctggcagcgccggtggaccgc
ctgttgcaacagctggcgaagcagcccccgatccaacaaaacttatatggcgatagcgcc
atcgatgaggaattagcatga

DBGET integrated database retrieval system