KEGG   Serratia ureilytica: J0X03_04295
Entry
J0X03_04295       CDS       T07185                                 
Symbol
recC
Name
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_04295 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_04295 (recC)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     J0X03_04295 (recC)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J0X03_04295 (recC)
SSDB
Motif
Pfam: Exonuc_V_gamma RecC_C
Other DBs
NCBI-ProteinID: QSR08217
LinkDB
Position
929707..933078
AA seq 1123 aa
MFTVYHSNQLDLLKTLTSALIARDPLADPFQQEVVLVQSPGMAQWLQMQLAEQFGIAANV
AFPLPATFIWDMFTRVLPDIPKESAFSKDAMTWKLMWLLPEMLTQPAFAPLQHYLTDDGD
KRKIHQLAGRVADLFDQYLVYRPQWLESWQRGERIDGLPEAQQWQAPLWARLVEYTRELG
QPEWHRANLYSRFIHALEQATTCPPGLPPRVFICGISALPPVYLEALQALGRHIDIHLMF
TNPCRYYWGDIQDYAFLARLQSRKRRHYHQAREQGLFREPADAARLFDAEGQQQLSNPLL
ASWGKLGRDHLYLLSQMEGAQEVDAFVDIPADTMLHAVQRDMLELEDHAVIGITAETLES
SFSKRRLDPQDRSLSLHACHSPQREVEVLHDQLLTMLAQDPALTSRDIIVMVADIDSYTP
YIQAVFGNAPAERYLPFAISDRKARQAHPALQAFISLLDLPQSRFTSEQVLALLEVPALA
ARFAIGEEGLRLLRHWVGESGVRWGLDDDNVRELDLPATGQHTWRFGITRMLLGYAMDSN
AGDWQGILPYDESSGLVAELAGQLADLLAQLSHWRQVLSEARSLEAWLPLCRQLLDAFFE
ADSDTEVVLALIEQQWQQAINFGLAARYPDDVPLTILRDDLAARLDQERISQRFLAGQIN
FCTLMPMRSIPFKVVCLLGMNDGVYPRTLPPLGFDLMAQQVKRGDRSRRDDDRYLFLEAI
LSAQQRLYISFIGRSIQDNSPRYPSVLVTELLEYLEQSYCLPGDEACTADDSARRVGEHL
LKWHARMPFAAENFLPGSEAQSYAAEWLPAADGRGAAHPAFNQLLPAETLQQISLDELLR
FYRHPIRAFFQLRLGVSFILEETELPDEEPFTLDNLSRYQFNSQLLNTLIDGDDPERLFQ
RVRAAGGLPYGAFGEIYWQKQQEEMSELAEQVRAERAQSHSLELDIDIAGVRLSGWLHQV
QDDGLLRWRPATLSAVDGILLWLEHLVYCCAGGTGESRMYGRKNSAWRFAALAPEEAQAQ
LAELLAGYQRGLCQPLLLLNKSGWAWLSQCYQPETQQIDWEEEAQTKARAKLLQAWQGDQ
RIPGEGEDPYVQRVFRQLDNDYLAQILAETERYLLPVACHNLG
NT seq 3372 nt   +upstreamnt  +downstreamnt
atgttcacggtttatcattccaatcagctggatttattgaaaacgctgaccagcgcgctg
atagccagagatccgttggccgatccttttcaacaggaagtggtgctggttcagagcccc
ggtatggcgcaatggctgcaaatgcagctggcggagcagttcggcatcgccgccaatgtc
gcgtttccgctgccggcgaccttcatttgggacatgttcacccgagtgttgccggatatc
ccgaaagagagcgccttcagcaaggacgccatgacctggaagctgatgtggctgctgccg
gagatgctgacccagccggcgttcgcgccactgcagcactatctcaccgatgacggcgac
aagcgcaaaatccaccaattggccggccgggttgccgaccttttcgaccagtatttggtt
tatcgcccgcagtggctggagagctggcagcgcggcgaacgcatcgacggtctgcccgag
gctcagcagtggcaggcgccgctctgggcgcggctggtggagtacacgcgcgaattgggg
cagccggaatggcaccgcgccaatctgtacagccgctttatccacgcgctggagcaggca
acaacgtgtccgcccggtttgccgccgcgggtgtttatctgcggcatctcggcgttgccg
ccggtctatctggaggcgctgcaggcgctggggcggcatatcgatatccacctgatgttc
accaacccttgtcgttattactggggcgacattcaggattacgctttcctggcccgcttg
cagagccgcaagcgccgtcactatcatcaggcgcgcgagcaagggctgtttcgcgaaccg
gctgacgcggcgcgtctgtttgacgctgaagggcagcagcagctcagtaacccgctgctg
gcctcctggggcaagctcgggcgcgatcacctctatttgctgtcgcagatggaaggggcg
caagaggtcgacgcctttgtcgatatcccggcggataccatgctgcacgccgttcaacgc
gatatgctggagctggaagatcacgcggtgatcggcatcacggcggaaacgctggaaagc
agtttcagcaagcgcaggctcgatccgcaagatcgttccctcagcctgcacgcctgccac
agcccacagcgggaagtggaggtgctgcacgatcaactgctgaccatgctcgcgcaggat
cccgcgttgacgtcgcgcgacatcatcgtgatggtggcggatatcgacagctatacgcct
tatattcaggccgtgttcggcaatgctcccgccgagcgctacctgccgttcgccatttct
gaccgtaaagcgcgacaggcgcatccggctttgcaggcgttcatctccctgctcgatctg
ccgcaaagccgctttacgtcggaacaggtgctggcgctgttggaagtgccggccctggcc
gcccgtttcgccattggcgaagaggggctgcgcctgttgcgtcactgggtcggtgaatcc
ggcgtgcgctgggggctggacgacgataacgtgcgagaactggatctgcccgccacgggc
cagcacacctggcgattcggcattacgcgcatgctgctcggttacgcgatggacagcaac
gccggcgattggcagggcattttgccttacgacgagtcgagcgggttggtcgccgaactg
gcggggcagttggcggatctgctggcccaattgagccattggcggcaagtcttgagcgaa
gcgcgctcgctcgaggcatggctaccgctgtgccgacagctgctggatgccttcttcgaa
gcggatagcgataccgaagtggtgctggcattgatcgagcagcagtggcaacaggccatc
aattttggcctggcggcgcgctatccggatgacgtgcccttgacgattctgcgcgacgat
ttggcggcgcgcctcgatcaggagcgcatcagccagcgcttcctcgccgggcaaatcaac
ttctgtacgctgatgccgatgcgctcgattccgttcaaggtggtgtgcctgctgggcatg
aacgacggcgtgtatccgcgcacgttgccgccattgggttttgatctgatggcgcagcag
gtcaagcgcggcgaccgcagccggcgcgatgacgaccgctatctgttcctggaggcgatt
ctgtccgcgcaacaacggctgtatatcagcttcattggccgttccattcaggacaacagc
ccgcgctatccttcggtgctggttaccgagctgctggagtatctggagcaaagctattgc
ctgccgggagacgaggcgtgcaccgcagacgacagcgcccggcgagtgggcgagcatttg
ctgaagtggcatgcgcgcatgccgttcgccgccgagaatttcttgccgggctcggaagcg
caaagctatgccgccgagtggctgcccgccgccgacgggcgcggggcggcgcacccggcc
ttcaaccagctgctgcccgccgaaacgctgcagcaaatatcgttggatgagctgctgcgg
ttttaccgccatcctattcgcgccttcttccagctgcggttgggcgtcagctttatcctg
gaagagaccgagctgccggacgaagagcccttcacgctggataacctcagccgctaccag
ttcaacagccaactgctgaataccctgattgacggcgacgatcccgaacggttgttccaa
cgggtgcgcgccgccggggggttgccctatggcgccttcggcgagatctattggcaaaag
cagcaggaagagatgagcgaactggccgagcaggtgcgtgcggaacgcgcgcagagccac
agcctggaattggatatcgatatcgccggcgtacgtctcagcggctggctgcatcaggtg
caggatgacggcctgttgcgctggcggcccgccacgttgtcggcggtggacggcatattg
ctgtggctggagcacctggtgtactgctgcgccggcggcaccggcgagagccgcatgtac
ggtcgcaagaactccgcctggcgctttgccgcgcttgcgcctgaagaggcgcaggcgcag
ctggcggaactgctggcgggctatcagcgcggtctgtgtcagccgctgctgttgctgaac
aagagcggctgggcgtggctgagtcagtgctatcagccggaaacgcagcaaatcgactgg
gaagaagaagcgcaaacaaaggctcgcgccaaattgctgcaggcttggcagggcgatcag
cgcattcccggagaaggggaagatccctatgttcagcgagtgttccgccaattggacaat
gactacctggcgcaaatactggccgaaacagagcgttatctgctgccggtggcgtgtcat
aacctggggtaa

DBGET integrated database retrieval system