KEGG   Serratia ureilytica: J0X03_04305
Entry
J0X03_04305       CDS       T07185                                 
Symbol
recB
Name
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_04305 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_04305 (recB)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     J0X03_04305 (recB)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J0X03_04305 (recB)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_12 AAA_11
Other DBs
NCBI-ProteinID: QSR08218
LinkDB
Position
936196..939747
AA seq 1183 aa
MTEVAPQRLEPLTLPLFGERLIEASAGTGKTFTIGALYLRLLLGLGGEAAFPRPLTVEEI
LVVTFTEAATEELRGRIRDNIHGLRIACVRGISANPLFSALMEEIDDLSDAAAQLLAAER
QMDEAAIYTIHGFCQRMLTHNAFESGMLFEQTLVQDELPLRRQACADFWRRHCYPLPLGV
ARAISQEWSGPEALLADLSGYLHGEAPALRRPPKDEETVLMRHEQIVARIDAIKAQWRAA
AGDLEALIAQSGVDKRSYSSKHLPNWLNKVGEWSGQETQDYQLPKELDKFRQSVLLEKTK
KGEPPRHALFTAIDELFDEPLTLRDLIMARALSEIRTSIQQEKRQRAELGFDDLLSRLDS
ALQSGGGEQLAQAIRQRYPVAMIDEFQDTDPQQYRIFQKLYVGRPDCGLLLIGDPKQAIY
AFRGADIFTYMRARSEVSAHYTLETNWRSSPSMVASVNHLFSQVEKPFLFGQIPFIEVNA
AEKNQGLAFELHGKPQPAMQFWLQQGEGAGVSDYQQLMARLCATQIRDWLSAGQQGLARL
QSGKASRPVQASDITVLVRSRNEAALVRDALSALSIPSVYLSNRDSVFDTPEAKDLLWLL
QAVLAPEQERTLRSAMATGLMGLDAPTLDGLSRDERAWDALVNEFDNYRTLWLRRGVLPM
LSEVMKTRQLAENLLASAGGERRLTDVLHLGELLQEAAAQLDSEHALVRWLAQQIAQPNR
QSDNQQLRLESDRHLVQVITIHKSKGLEFDLVWLPFVGNFRQQQQALYHDRHSFQALLDL
DANEESQAWAEEERLAEDLRLLYVALTRSVYHCSIGIAPLFQGTRKKQGDTDLHRSALGY
LVQGGQPGDAVYLQERLQQLVGGGIALSLVEPPDAEPWQPQASLAEALAAKSFTRRIQDF
WRVTSYTGLQQHGASLMQDLLPRLDVDAAGERGEESEPALTPHTFPRGATPGTFLHSLFE
TLDFTQPLDEQWLLEQLQQQGFAEHWQPILLAWMQVLLNTPLDDSGVTLAALTPQHKQAE
LQFYLPINRLLQAKELDALVKRYDPLSARCPALDFHQVQGMLKGFIDLVFCWQGKYYLLD
YKSNWLGEDSSAYTRPAMEQAMAEHRYDLQYQLYTLALHRYLRHRLPDYDYRRHFGGVIY
LFLRGVDAAHPGNGIYTCLPAFELVAGMDSLFSGEAAATEEKS
NT seq 3552 nt   +upstreamnt  +downstreamnt
atgacggaagtcgccccgcagaggctagagccgctgacgctgccgctgtttggcgaacgc
ctgatcgaggcgtcggcgggcaccggcaaaacttttaccatcggcgcgctgtatctgcgc
ttgctgctgggattggggggggaagcggcgtttccccgcccgttgacggtcgaagaaatc
ctggtggtgacctttaccgaggccgccaccgaggagctgcgcgggcgtatccgtgacaat
atccacgggctgcgcatcgcctgcgtgcgcggcatcagcgctaacccgctgttttcggcg
ctgatggaagaaattgacgatttgtctgacgccgctgcgcagctgctggcggcggagcgg
cagatggacgaagcggcgatttacactatccacggcttttgccaacggatgttgacccac
aacgccttcgagtccggcatgctgtttgaacaaacgctggtgcaggacgaactgccgctg
cggcggcaggcctgcgccgatttctggcgccgtcattgctatccgttgccgctgggcgtg
gcgcgtgcgatcagccaggagtggagcggcccggaagcgttgctggccgacctttccggt
tatctgcacggtgaagcgccggcgctgcggcggccgccgaaggacgaagaaaccgttctg
atgcgccacgagcagattgtcgcgcgcatcgacgccatcaaggcgcaatggcgggcggcg
gcgggcgatcttgaggcgttaatcgcccagtccggcgtcgataagcgcagctacagcagc
aaacacctgccgaactggttgaacaaggtcggcgaatggagcgggcaggagacccaggat
taccaactgccgaaggagctggacaagtttcgccagtcggtgctgctggagaagaccaag
aagggcgagccgccgcgtcatgcgctgttcacggcgatagacgaactgttcgatgaaccc
ttgacgttgcgcgacctgatcatggcgcgcgcgctcagcgagatccgcacctccattcag
caggaaaagcgccagcgcgccgagctggggtttgacgacctgctcagccgtttggacagc
gccctgcaaagcggcggcggcgaacagttggcgcaggcgatccgccagcgctatccggtg
gcgatgatcgatgaattccaggataccgatccgcagcaataccgtattttccaaaaactt
tacgtcggccggcctgattgcggcctgctgctgatcggcgatcccaagcaggcgatttac
gcctttcgcggcgccgacatctttacctacatgcgcgcgcgttcagaggtgagcgcccac
tatacgctggagaccaactggcgctcgtcgccgtcgatggtcgccagcgtcaatcacctg
ttttctcaggtagaaaaacctttcctgttcggccaaatcccctttattgaggttaacgcg
gcggaaaagaaccaagggctggcgtttgaattgcacggcaagccgcagccggcgatgcaa
ttctggctgcagcagggggaaggcgcgggtgtaagtgattaccaacagctaatggcgcgc
ctgtgcgccacgcaaattcgcgactggctcagcgccgggcagcagggcctggcgcggctg
cagagcggcaaggcgtcacggccggtgcaagcctctgatatcacggtgctggtgcgcagc
cgcaacgaggcggcgttggtgcgcgatgcgctcagcgcgctgtctattccgtcggtctac
ctgtccaaccgcgacagcgtgtttgacaccccggaggccaaagacctactgtggttgctg
caggcggtgttggcgccggagcaggagcgcacgctgcgcagcgccatggccaccgggctg
atggggctggacgcgccgacgctggacggcctgagccgcgatgagcgcgcctgggacgcg
ctggttaatgaattcgacaattaccgcacgctctggctgcgccgcggcgtgttgccgatg
ctgagcgaggtgatgaaaacgcgccaattggcggagaacctgctggccagcgccggcggc
gagcgtcgcttgaccgacgtgctgcatctgggggagctgttgcaagaagcggcggcgcag
ctcgacagcgagcatgcgctggtgcgctggctggcgcagcagatcgctcagcctaatcgc
cagtccgacaatcagcaactgcggctggagagcgaccggcatctggtgcaggtgatcacg
atccacaagtccaaggggctggagttcgatctggtgtggctgccgttcgtcggcaacttc
cgccagcagcagcaggcgctgtatcacgatcgccacagtttccaggcgttgctggacctc
gacgccaatgaagagagccaggcctgggcggaggaggagcggttggcggaggatctgcgt
ctgctgtatgtggcgctgacccgctcggtgtaccactgcagtatcggcattgcgccgctg
ttccagggcacgcgcaagaaacagggcgataccgacctgcaccgcagcgcattgggctat
ctggtgcagggcgggcagcccggcgacgccgtgtatctgcaggagcggctgcagcaattg
gtgggtggcggtatcgcgctgtcgctggttgaaccgccggatgcagaaccctggcaaccc
caggcgtcgctggccgaagcgttggcggcgaaaagctttacccggcggatccaggatttt
tggcgggtgaccagctataccggtttgcaacagcacggcgcgagcctgatgcaggatctg
ctgccgcgtctggatgtcgacgcggccggtgagcgcggggaagaaagtgagccagcgctt
acaccgcataccttcccgcgcggcgcaacgcccggcaccttcctgcacagcctgtttgaa
acgctggacttcacccagccgctcgacgaacagtggctgctggaacagctgcagcagcaa
gggtttgccgaacactggcaaccgatactgctggcgtggatgcaggtgctgctcaatacg
ccgctcgatgacagcggcgtgacgttggcggcgctgacgccgcagcataagcaggcagag
ctgcagttctatttaccgattaaccggctgttgcaggcgaaggagctcgatgctctggtg
aagcgttacgatccgctttccgcccgctgcccggcgctggatttccatcaggtgcagggc
atgctgaaaggctttatcgacctggtgttctgctggcaaggcaaatactacctgctggac
tacaagtccaactggctgggggaggacagcagcgcctatacccggccggcgatggagcag
gcgatggcggagcatcgttatgatctgcaataccagctgtatacgctggcgttgcatcgt
tatttgcgccatcggttgccggattatgattaccggcgccatttcggcggggtgatttat
ctgttcctgcgcggcgtggatgcggcgcacccgggcaacggcatttacacctgtctcccc
gcgtttgagctggtggcgggaatggatagcttgttcagcggcgaagctgcggcgacggag
gaaaaatcatga

DBGET integrated database retrieval system