KEGG   Serratia ureilytica: J0X03_04310
Entry
J0X03_04310       CDS       T07185                                 
Symbol
recD
Name
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_04310 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_04310 (recD)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     J0X03_04310 (recD)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J0X03_04310 (recD)
SSDB
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 AAA_22 SH3_13 DUF2075 UvrD-helicase PhoH AAA_28 CbiA T2SSE AAA_16 UvrD_C AAA DO-GTPase1 SRP54 MukB AAA_24 NTPase_1 DUF87
Other DBs
NCBI-ProteinID: QSR08219
LinkDB
Position
939744..941594
AA seq 616 aa
MIALLEQAVALGALRPLDVQFARVVASEDEPDILLAAACLSAEAGAGHVCLMLEQLQADT
LFEGRQPALALALWEAAGRPDSARWQQRLASSAAVGDGSGATPLVLRGQRLYLQRMWQNE
GEVAAFIGGEGESLTVPEEALRAILDRLFGAASDEPDWQKIAAAVAATRRIAVISGGPGT
GKTTTVAKLLAALVQLDESARLRIQLAAPTGKAAARLTESLGSASRQLALTPAQQALFPT
EAATLHRLLGAQPNSQRMRYHRGNRLHLDVLVVDEASMVDLPMMARLIAALPDRARVIFL
GDRDQLASVEAGAVLGDICRFAEQGYSEARAAELSRLTGCSIEGQRADAQAAVRDSLCLL
RKSYRFDARSGIGQLALAVNAGAGDGALAALNGRFGDVAGYALATSEEYQALLDACVAGY
RDYLRLTAEGADAAAVLAAFSRFQVLCALREGPFGVAGLNERIELGLQRAGLIDRKPGVL
GRWYRGRPVMIGRNDSALGLFNGDIGITLPDERGELRVHFQLPDGSIKSVQPSRLPAHET
AYAMTVHKSQGSEFEHTVLVLPNHFLPVLTRELVYTAITRARQQLSLYATDAVLLRAIRT
PTQRRSGLAERLQTTE
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgatcgcactgctggagcaggcggtggcgcttggcgcgctgcgcccgctggacgtgcag
ttcgcccgcgtggtggcgagcgaagacgagcctgatattttactggccgccgcctgtctg
agcgctgaggcgggggcggggcatgtttgcctgatgctggagcagctgcaggcggacacg
ctgtttgaagggcgccaaccggcgctggcgctggcgctgtgggaggcggccgggcgaccg
gatagcgcacgttggcagcagcgcctggcgagcagcgcggcggttggggacggcagcggc
gctacgccgctggtgctgcgtgggcagcgcttatatctgcaacgcatgtggcaaaacgaa
ggtgaagtggcggcgtttatcggcggtgaaggtgaatcgctgacggtgccggaggaggcg
ttgcgcgccattctcgaccgcttgttcggcgcggcgagcgatgaacccgactggcagaag
atcgctgctgcggtggctgccacgcggcgcatcgcggtgatttccggcggaccgggcacc
ggtaaaaccaccaccgtcgctaaactgctggcggcgttggtgcagctggatgaaagcgcg
cgcttgcggattcagctggcggcgccaaccggcaaggcggcggcgcgcctgacggagtcg
cttggcagcgccagccgtcagctggcgttgaccccggcgcagcaggcgttgttccccacg
gaggcggcgacgttacaccgtctgttgggggcgcaacccaacagtcagcgcatgcgctat
caccgcggtaaccgtctgcatttggatgtgttggtggtggatgaggcctcgatggtcgat
ctgccgatgatggcgcgcctgattgcggcgttgcccgatcgggcccgggtgattttcctc
ggcgaccgcgatcagctggcctcggtggaggccggcgcggtgttgggggatatttgccgt
tttgccgagcagggatacagcgaggcgcgcgccgcagagctgagccgcctgaccggttgt
tcgatcgaaggacagcgggccgacgcgcaagcggcggtgcgcgacagcctgtgcctgttg
cgcaagagctatcgcttcgacgcccgttccggcatcggtcaactggcgttggcggtcaac
gccggtgcgggggatggtgcgctggcggcattaaacggccgtttcggcgatgtcgcgggc
tatgcgctggcgacgagcgaagagtatcaggcgctgctggacgcgtgcgtggcgggctat
cgcgactatctgcggctgactgccgaaggcgcggatgcggcggcggtgctggccgccttt
agccgcttccaggtgctgtgcgcgctgcgtgaagggccgttcggcgtcgccggcctgaat
gaacgtattgaactcgggctgcagcgcgccggcctgatcgaccgcaaaccgggtgtgctc
ggccgctggtatcgggggcggccggtgatgatcggccgcaacgacagcgcgctggggtta
ttcaatggggatatcggcattactctgccggatgagcgcggcgagctgcgcgtgcatttc
caactgccggacggcagcatcaagtcggtgcagccgagccgtttgccggcgcatgaaacc
gcttacgccatgacggtgcacaagtcccagggatcggagtttgagcatacggttctggtg
ttgccgaaccatttcctgccggtgctgacgcgtgagctggtctataccgcgatcacccgt
gcgcgtcagcagctctcgctgtacgccacggacgcggtgctgctgcgggccattcgcacg
ccgacccagcgtcgcagcggattggctgaacggctgcagacgacggaataa

DBGET integrated database retrieval system