KEGG   Serratia ureilytica: J0X03_04990
Entry
J0X03_04990       CDS       T07185                                 
Symbol
ung
Name
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
suri  Serratia ureilytica
Pathway
suri03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    J0X03_04990 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_04990 (ung)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     J0X03_04990 (ung)
DNA repair and recombination proteins [BR:suri03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     J0X03_04990 (ung)
 Prokaryotic type
     J0X03_04990 (ung)
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-ProteinID: QSR08340
LinkDB
Position
complement(1077981..1078664)
AA seq 227 aa
MATSLTWHDVIGKEKEQPYFVETLAFVAAERQAGKTIYPPQKDVFNAFRFTELADVKVVI
LGQDPYHGPNQAHGLSFSVRPGVPAPPSLVNMYKELATDIPGFERPDHGYLQSWAEQGVL
LLNTVLTVEGGRAHSHANLGWETFTDKVIAALNENREGVVFLLWGSHAQKKGNFIDRNRH
HVLKAPHPSPLSAHRGFLGCRHFSQANQLLEQQGLTPIDWMPRLPQA
NT seq 684 nt   +upstreamnt  +downstreamnt
atggccacctccctcacctggcatgacgtgatcggcaaagagaaagagcagccctatttt
gttgaaacgctcgcctttgttgccgctgagcgccaggccggtaagaccatttacccaccg
cagaaagacgtgttcaacgcgttccgctttaccgagctggcggacgtcaaagtcgtcatc
ctcggccaggatccctaccacggccccaatcaggcgcacggcctctctttctcggtgcgc
cccggcgtgccggcgccgccgtcgctggtgaacatgtataaagagctggcgaccgacatt
cccggtttcgaacgccctgatcacggctacctgcaaagctgggccgaacagggggtgctg
ctgctcaacaccgtgctgacggtggaaggcggccgcgcgcactcgcacgccaacctgggc
tgggaaacctttaccgataaagtgatcgccgccctgaacgagaaccgcgaaggcgtggtg
ttcctgctgtggggctcgcacgcgcagaagaaaggcaactttatcgaccgcaaccgccac
catgtgctgaaagcgccgcacccgtcgccgctctccgcgcaccgcggtttcctcggctgc
cgccacttctcgcaggccaatcagctgctggagcagcaagggctcacgccgatcgactgg
atgccgcgcctgccgcaggcgtag

DBGET integrated database retrieval system