KEGG   Serratia ureilytica: J0X03_05650
Entry
J0X03_05650       CDS       T07185                                 
Symbol
alkA
Name
(GenBank) DNA-3-methyladenine glycosylase 2
  KO
K13529  AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
suri  Serratia ureilytica
Pathway
suri03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    J0X03_05650 (alkA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:suri03000]
    J0X03_05650 (alkA)
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_05650 (alkA)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     J0X03_05650 (alkA)
Transcription factors [BR:suri03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    J0X03_05650 (alkA)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     J0X03_05650 (alkA)
SSDB
Motif
Pfam: AlkA_N Ada_Zn_binding HTH_18 HTH_AraC HhH-GPD DUF1952 HTH_23 HTH_28
Other DBs
NCBI-ProteinID: QSR08468
LinkDB
Position
1223827..1225317
AA seq 496 aa
MQKKPNPSVAMNTQQQALYDALRARDRKFDGRFFVGVSSTGIYCRPVCSARTPKLENCTF
YPSAAAAELAGFRPCLKCRPELAPGLALIDLGNRYAQVAVQLIEQGYLSEHSCEALAARL
GISDRHLRRIFAEQFGASPIDYAQSHRLLQAKRLLADTDLPLSEVAFAAGFGSLRRFNEL
FKARYRLIPSALRSGGARGERAAASGLVFHLGYRPPYDWARMLNFLQARAVQGVERVEGR
RYLRSIAVSQGGTEHRGWLSVQPEEARNRVRVEIAPTLSLVTTEVLRRVRLLFDLDAAPD
RINEALGSLAADAPGLRLPGCVNSFEQAARAVLGQLVSVKMAATFAGRMAERWGEALATP
HEGITHVFPTAERVAQLQPEELRPLGVQVKRAAALIEIARALGEGRLQLDNVLDIEQGIK
ALTALPGIGNWTASYIAMRAWSWPDVFLAGDYLIKQRFPGMTPRQIERYAERWRPWRSYA
TLHLWHNGGWAPEGES
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgcagaaaaaaccgaacccgagcgttgccatgaatactcaacagcaagcgttgtacgac
gcgctgcgcgcgcgtgaccgcaaattcgacggccgttttttcgtcggcgtctcttccacc
ggcatctattgtcgcccggtgtgcagcgcccgcacgccgaagctggaaaactgcaccttt
tatccgagcgcggcggcggctgaactggcggggtttcgcccctgcctcaaatgccgaccg
gaactggcgcccggcctggcgctgatcgatctgggcaaccgctatgcccaggtggcggtg
cagctcatcgagcaggggtatctgtccgaacacagctgcgaagcgctggcggcgcggctg
ggcatttccgatcgccatctgcggcgcatcttcgccgaacagtttggcgcctcgccgatc
gattacgcgcagtcgcaccggttgctacaggccaagcgcctgctggcggacaccgatctg
ccgctcagcgaggtggcgttcgccgccggtttcggcagcctgcggcgtttcaacgagctg
ttcaaggcgcgttaccgcctgatcccgtcggcgctgcgcagcggcggcgcgcgcggtgaa
cgggccgccgccagcgggttggtgtttcacctgggctatcggccgccctatgactgggcg
cgcatgctgaatttcttgcaggcgcgcgccgtgcagggcgtggagcgggtcgaggggcgc
cgctacctgcgctcgatcgccgtcagccagggcggcacggaacaccgcggctggctcagc
gtgcagccggaagaggcgcgcaatcgggttcgggtcgagattgcgccgacgctcagtctg
gtgacgacggaggtgttgcgccgggtgcgcctgctgtttgatctggacgccgcgccggat
cgcatcaatgaggcgctgggctcgctggcggccgatgcgccggggctgcgcctgccgggc
tgcgtgaacagtttcgagcaggcggcgcgtgcggtgctggggcagttggtcagcgtgaaa
atggcggcgaccttcgccgggcggatggccgaacgctggggcgaagcgctggcgacgcca
catgagggcatcacccacgttttccccacagcagaacgggtggcgcagctgcagcctgaa
gaactgcgcccgctcggggtgcaagtgaagcgtgcggcggcgctgatcgagatcgcccgc
gcgctgggggaaggacggctgcagctcgacaacgtgctggatatcgaacagggcatcaag
gcgctgaccgcgctgccgggcatcggcaactggaccgccagctatatcgcgatgcgcgcc
tggtcgtggccggacgtgttcctggccggcgactacctgatcaaacagcgtttccccggt
atgacgccgcgccagattgaacgctacgccgaacgttggcgcccgtggcgctcttacgcc
acgctgcacctgtggcacaacggcggctgggcgccggaaggagagagttga

DBGET integrated database retrieval system