KEGG   Serratia ureilytica: J0X03_14210
Entry
J0X03_14210       CDS       T07185                                 
Symbol
exoX
Name
(GenBank) exodeoxyribonuclease X
  KO
K10857  exodeoxyribonuclease X [EC:3.1.11.-]
Organism
suri  Serratia ureilytica
Pathway
suri03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    J0X03_14210 (exoX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_14210 (exoX)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.-
     J0X03_14210 (exoX)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     J0X03_14210 (exoX)
SSDB
Motif
Pfam: RNase_T ExoX-like_C
Other DBs
NCBI-ProteinID: QSR05612
LinkDB
Position
3033497..3034165
AA seq 222 aa
MTLRVIDTETCGLDGGVVEVASLDLLDGQLTNPMSDLISPDRPISLDAMAIHHITEQMVE
GKPRIAVAIGRYQGSPYYVAHNAAFDRGVLPEMNGAWICTLKLARTLYPDIKYGNQYLRY
ALNLDVQLPADATLYPHRALYDCYVTAALLQRIIKDSGWTPEQMVQITEQPVLLKKFKFG
KYRGQEIDRIAQEDPGYLRWMLKSIDDLSPDMKHTLKYYLIG
NT seq 669 nt   +upstreamnt  +downstreamnt
atgacgttacgcgtaatagataccgagacctgcgggctggacggcggcgtggtggaagtg
gcctccctcgatctgctcgacggccaattgaccaacccgatgagcgacctgatcagcccg
gaccgccccatcagcctcgacgcgatggcgattcatcacatcaccgaacagatggtggaa
ggcaaaccgcgcattgcggtggcgatcggccgctatcagggcagcccctactatgtggcg
cacaacgccgcctttgatcgcggggtgttgccggagatgaacggcgcctggatctgcacc
ctcaagctggcgcgcacgctgtatccggacatcaagtacggcaaccagtatctgcgttac
gcgctgaatctggacgtgcagttgccggcagacgccacgctgtacccacaccgcgcgctg
tatgactgctacgtcaccgccgcgctgctgcaacgcatcatcaaggattcgggctggacg
ccggagcaaatggtgcagatcaccgaacagccggtgctgctgaagaagttcaagttcggc
aagtatcgcgggcaggagatcgaccgcatcgcccaggaagaccccggctatctgcgctgg
atgctgaaatccatcgacgatctgagcccggacatgaaacacacgctgaaatactatctg
attggctaa

DBGET integrated database retrieval system