Serratia ureilytica: J0X03_14465 Help Entry J0X03_14465       CDS       T07185                                  Symbol dinI Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism suri  Serratia ureilytica Brite KEGG Orthology (KO) [BR:suri00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:suri03400]     J0X03_14465 (dinI) DNA repair and recombination proteins [BR:suri03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     J0X03_14465 (dinI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  QSR05656 LinkDB All DBs Position 3084438..3084677 Genome browser AA seq 79 aa AA seqDB search MRVEVTIDKTRPLPSGAIEALTGELGKRVNRQFPDAVVHVRYAGANGLSVLGGAKIDRDL IEEILQETWESADEWFSAE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaagtcactatagataaaacccggccgctgccgtcgggcgccattgaggcg ctgaccggcgagctgggcaaacgggtcaatcgccagtttccagacgccgtcgtgcacgtc cgttatgccggcgccaacgggctctccgtgctggggggcgccaaaatcgaccgggatctg attgaggaaatccttcaggaaacctgggaaagcgcggacgaatggttcagcgcagaataa

DBGET integrated database retrieval system