KEGG   Serratia ureilytica: J0X03_20050
Entry
J0X03_20050       CDS       T07185                                 
Symbol
mutS
Name
(GenBank) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
suri  Serratia ureilytica
Pathway
suri03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    J0X03_20050 (mutS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_20050 (mutS)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     J0X03_20050 (mutS)
SSDB
Motif
Pfam: MutS_V MutS_I MutS_III MutS_II MutS_IV
Other DBs
NCBI-ProteinID: QSR06677
LinkDB
Position
4222351..4224912
AA seq 853 aa
MNDDLDKDFSSHTPMMQQYLRLKAQHPEILLFYRMGDFYELFYDDAKRASQLLDISLTKR
GASAGEPIPMAGVPHHAVENYLAKLVQLGESVAICEQIGDPATSKGPVERKVVRIVTPGT
ITDEALLQERQDNLLAAIWQDARGFGYATLDVSSGRFRVAEPQDLETMAAELQRTNPAEL
LYPEAFEQMALIEQRHGLRRRPLWEFELETARQQLNLQFGTRDLTGFGVEQAHQALRAAG
CLLQYVKDTQRTSLPHIRGITMERQQDGIIMDAATRRNLELTQSLSGGSDNTLAAILDRT
VTPMGSRMLKRWLHMPTRDIKVLTARQQAIGALQERFADLQPSLRQVGDQERILARLALR
TARPRDLARMRHAFQQLPDIRAVLQDVDTPHVQQLLSQVGQFDELRELLERAIVESPPVL
VRDGGVIAPGYNSELDEWRALADGASDYLDRLEIREREKLGLDTLKVGFNGVHGYYIQVS
RGQSHLVPIHYVRRQTLKNAERYIIPELKEYEDKVLTSKGKALAIEKSLYDELFDLLLPH
LAELQQSAAALAELDVLANLAERADTLNYACPVMSEQPGIRITEGRHPVVEQVLSEPFIS
NPLSLSPQRRMLIITGPNMGGKSTYMRQTALIVLMAHIGSYVPAAKATIGPVDRIFTRVG
AADDLASGRSTFMVEMTETANILHNATEHSLVLMDEIGRGTSTYDGLSLAWACAENLANR
IKAMTLFATHYFELTTLPEKMEGVVNVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAAL
AGVPRDVIKRARQKLRELESISSHTASGSVDATQMTLLQEETSPAVEALEALDPDSLSPR
QALEWIYRLKNMV
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaatgatgatcttgataaggacttctctagccacacgccgatgatgcagcagtacctg
cgcctcaaggcccagcatcctgaaatcctgctgttctaccgcatgggtgacttctacgag
ctgttttacgacgacgccaagcgcgcttcccaactgctggatatctcgctgaccaaacgc
ggcgcctcggcgggcgagccgatcccgatggccggcgtgccgcaccacgcggtggagaac
tacctggccaagctggttcaactcggcgaatccgtcgccatctgtgaacagatcggcgat
ccggccaccagtaaagggccggtcgagcgcaaagtggtacgcatcgtcacccccggcacc
atcaccgacgaagcgctgctgcaagagcgccaggacaacctgctggcggcgatctggcag
gatgcgcgcggcttcggttacgccacgctggacgtgagctccggccgcttccgcgtcgcc
gagccgcaggatctagagaccatggccgccgagctgcagcgcaccaatccggccgagctg
ctctacccggaagccttcgaacaaatggcgctgatcgagcagcgccacggcctgcgccgc
cgtccgctgtgggaattcgaactggagaccgcacgccaacaactcaacctgcagttcggc
acccgcgatttgaccggcttcggcgtcgagcaggcgcatcaggcgctgcgcgccgccggc
tgtctgttgcagtacgtgaaagatacccagcgcacttcgctgccgcacattcgcggcatc
accatggagcgtcagcaggacggcatcatcatggacgccgccacccgccgcaacctggag
ctgacgcagagcctgtccggcggcagcgacaacacgctggcggcgatcctcgatcgcaca
gtcacgccgatgggcagccgcatgctgaaacgctggctgcacatgccgacccgagacatc
aaggtgctgaccgcccgccagcaggcgatcggcgcattgcaggaacggttcgccgatctg
cagccttcgctgcgccaggtgggcgatcaggagcgaattttggcgcgcctggcgctgcgc
accgcgcggccacgcgatctggcccgcatgcgtcatgctttccagcaactgccggacatc
cgcgcggtgctgcaagatgtggatacgccgcatgtgcagcaactgctatctcaggtaggc
cagttcgacgagctgcgcgaactgctggaacgcgcgatcgttgaatcgccgccggtgctg
gtgcgcgacggcggcgtgatcgcccccggttacaacagcgagctggacgagtggcgcgcg
ctggccgacggcgccagcgactacctcgatcggctggagatccgcgagcgtgaaaagctg
gggctggatacgctcaaagtcggcttcaacggcgtacacggctactacattcaggtgagc
cgcggccagagccacctggtgccgatccactatgtacgtcgccagacgctgaaaaacgcc
gagcgctacatcatcccggaattgaaagagtacgaagacaaggtactcacctccaagggc
aaagcgctggcgatcgagaaaagcctgtacgacgagctgttcgatctgctgctgccgcac
ctggcggaactgcaacaaagcgccgccgcgctggccgagctggacgtgctggccaacctg
gccgagcgcgccgacaccctgaactacgcctgcccggtcatgagcgaacaaccggggatc
cgcattaccgaaggccgccacccggtggtggagcaggtgctgagcgaaccgtttatctcc
aacccgctctccctgtcgccacagcgccgcatgctgatcatcaccggtccgaacatgggt
ggtaaaagtacctatatgcggcaaacggcgctgattgtgctgatggcgcacatcggcagc
tacgttccggctgccaaagccaccatcggcccggtggatcgcatcttcacccgcgtcggc
gcggcggacgatctggcttccggccgttccaccttcatggtggagatgaccgaaaccgcc
aatattcttcacaacgccaccgagcacagcctggtgttgatggatgaaatcggccgtggc
acctccacctacgacggcctgtcgctggcctgggcctgcgccgagaacctggccaaccgc
atcaaagcgatgacactgttcgccacccactatttcgagctgacgacgctgccggaaaaa
atggaaggcgtggtcaatgtgcatctggacgcgcttgagcacggcgacaccatcgctttt
atgcacagcgtgcaggacggtgccgccagcaaaagctatggcctggcggtcgccgcgctg
gccggcgtgccgcgcgacgtcatcaagcgcgcccgccaaaagctgcgcgagctggaatcc
atctccagccacaccgcgtcgggcagcgttgatgccacccagatgacgctgttgcaggaa
gagacttcgccggcggtagaagccctggaggcgctggatccggattccctgtcgccgcgc
caggcgctggaatggatctaccggctgaaaaatatggtgtag

DBGET integrated database retrieval system