KEGG   Serratia ureilytica: J0X03_23090
Entry
J0X03_23090       CDS       T07185                                 
Symbol
uvrD
Name
(GenBank) DNA helicase II
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
suri  Serratia ureilytica
Pathway
suri03420  Nucleotide excision repair
suri03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    J0X03_23090 (uvrD)
   03430 Mismatch repair
    J0X03_23090 (uvrD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_23090 (uvrD)
Enzymes [BR:suri01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     J0X03_23090 (uvrD)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     J0X03_23090 (uvrD)
   MMR (mismatch excision repair)
    Other MMR factors
     J0X03_23090 (uvrD)
SSDB
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 AAA_30 UvrD_C_2 PhoH
Other DBs
NCBI-ProteinID: QSR07235
LinkDB
Position
complement(4875163..4877325)
AA seq 720 aa
MDVSDLLDSLNEKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLLSVENCSPYSIMAV
TFTNKAAAEMRHRIEHLIGTSQGGMWIGTFHGLAHRLLRAHHLEANLPQDFQILDSDDQL
RLLKRIIKALNVDEKQWPPRQAMWYINGKKDEGLRPQHVETYNNPVEATWLRIYQAYQEA
CDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNVLVDEFQDTNSIQYAWIRLLAGGN
SNVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAETIRLEQNYRSTSNILKAANTLIANN
DGRMGKNLWTEGGEGEPISIYCAFNELDEARFVVNRIKTWQDNGGALNDCAILYRSNAQS
RVLEEALLQTAMPYRIYGGQRFFERQEIKDALAYLRLISNRNDDAAFERVVNTPTRGIGD
RTLDVVRQAARDRQLTLWQATRELMQDKVLAGRAASALQRFIELVESLAHETADMPLHVQ
TDRVIRDSGLFIMYEQEKGEKGQARIENLEELVTATRQFSYQEEDQDLMPLQAFLSHAAL
EAGEGQADAYQDAVQLMTLHSAKGLEFPLVFIVGMEEGMFPSQMSLDEGGRLEEERRLAY
VGVTRAMQKLTLTYAETRRLYGKEVYHRPSRFIGELPEECVEEVRLRASVSRPVNHRRMG
TPISENDTGYKLGQRVRHPKFGEGTIVNLEGSGEHSRLQIAFPGEGIKWLVAAYARLETV
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggacgtctccgatctgctcgacagcctgaatgaaaaacaacgtgaagccgtggcggcg
ccgcgcagcaacctgttggttctggccggagcgggcagcggcaagacgcgggtgctggtg
catcgcatcgcctggctgctgtcggtggagaactgctcaccgtattcgatcatggcggtg
accttcaccaacaaggcggcggcggaaatgcgccaccgtatcgaacatctgatcggcacc
agccagggcggcatgtggatcggcactttccacggtctggcgcaccgcctgctgcgcgct
catcatctggaagccaacctgccgcaggatttccagatcctcgacagcgacgaccagttg
cggttgctcaagcgcatcatcaaggcgctgaacgtcgacgagaaacagtggccgccgcgt
caggcgatgtggtacatcaacggcaagaaagacgaaggcctgcgcccgcagcacgtcgag
acctacaacaacccggtagaggccacctggctgcgtatctaccaggcctatcaggaagcc
tgcgatcgcgcggggctggtggatttcgccgagctgctgctgcgcgcgcacgagctgtgg
ctgaacaagccgcatatcctcaaccactatcgcgaacgtttcaccaacgtgctggtggac
gaattccaggataccaacagcatccagtacgcctggatccgcctgctggcgggcggcaac
agcaacgtgatgatcgtcggcgacgatgaccagtcgatctacggctggcgcggcgcgcag
gtggaaaacatccagcgcttcctgaaggatttccccggcgcggaaaccatccgcctggag
cagaactaccgttccaccagcaacatcctgaaagcggccaacaccctgatcgccaacaac
gacgggcgcatgggtaaaaacctgtggaccgaaggcggcgaaggcgaaccgatctccatt
tactgtgccttcaacgaactcgacgaagcgcgcttcgtggtcaaccgcatcaagacctgg
caggacaacggcggggcgctgaacgactgcgccatcctgtaccgcagcaacgcccagtcg
cgcgtgctggaagaggcgctgctgcagacggcgatgccgtaccgcatctacggcggccag
cgcttcttcgaacgccaggaaatcaaggatgcgctggcttacctgcgcctgatctccaac
cgcaacgacgacgcggcctttgagcgcgtggtcaacaccccgacgcgcggcatcggcgat
cgcaccctcgacgtggtgcgccaggcggcgcgcgatcgccagctgacgctgtggcaggcg
acgcgcgaactgatgcaggacaaggttctggccggccgcgccgcgtcggcgctgcagcgc
ttcatcgagctggtggagtcgctggcgcatgaaaccgccgatatgccgctgcacgtgcag
accgatcgggtgatccgcgattccgggctgttcatcatgtatgagcaggagaaaggcgaa
aaggggcaggcgcgcatcgaaaaccttgaggaactggtgacggcgacgcgccagttcagc
tatcaggaagaagatcaggatctgatgccgctgcaggcgttcctgtcgcatgcggccctg
gaggcgggcgaaggccaggccgacgcctatcaggacgcggtgcagctgatgaccctgcac
tcggccaaggggttggagttcccgctggtgtttatcgtcggcatggaagaaggcatgttc
ccgagccagatgtcgctggacgaaggcggccgtctggaggaggagcgccgtctggcctat
gtgggcgtgacgcgcgccatgcagaaactgacgctgacctatgctgaaacgcgccgtctg
tacggcaaagaggtttatcaccggccgtcgcgctttatcggcgaattgccggaggagtgc
gtggaagaagtgcgcctgcgcgccagcgtatcgcgcccggtcaatcaccgccgcatgggc
acgccgatcagcgagaacgacaccggttacaagctgggccagcgcgtgcgtcatcccaag
tttggcgaaggcaccatcgtcaatctggagggcagtggcgagcacagccggctgcagatc
gccttcccgggtgagggcatcaaatggctggtggcggcctacgcgcgtttggaaacggta
taa

DBGET integrated database retrieval system