Staphylococcus ureilyticus: MUA21_04570 Help Entry MUA21_04570       CDS       T08759                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sury  Staphylococcus ureilyticus Pathway sury01100   Metabolic pathways sury01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sury00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MUA21_04570    00074 Mycolic acid biosynthesis     MUA21_04570   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MUA21_04570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  UXS60872 LinkDB All DBs Position 939660..939893 Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDAEKVTQDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNFINSMEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgacaaagtaaaagatatcatcgttgaccgtttaggtgttgacgctgaa aaagtaactcaagatgcatctttcaaagatgatttaggcgctgactcacttgatattgct gaattagttatggaattagaagacgaatttggtactgaaattccagatgaagaagctgaa aaaatcaacactgttggtgatgcagttaactttatcaatagtatggaaaaataa

DBGET integrated database retrieval system