KEGG   Candidatus Solibacter usitatus: Acid_0453
Entry
Acid_0453         CDS       T00412                                 
Name
(GenBank) ABC transporter related
  KO
K18890  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sus00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Acid_0453
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sus02000]
    Acid_0453
Transporters [BR:sus02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    Acid_0453
SSDB
Motif
Pfam: ABC_membrane ABC_tran AAA_22 SMC_N AAA_16 AAA_25 RsgA_GTPase SbcC_Walker_B AAA_29 TsaE Zeta_toxin DO-GTPase2 GTP_EFTU DUF87 MobB MMR_HSR1 SRP54 AAA_30
Other DBs
NCBI-ProteinID: ABJ81463
UniProt: Q02BV3
LinkDB
Position
complement(557614..559434)
AA seq 606 aa
MEEEVLGKAYDGRLMRRLLGYMRPYRLLVALSLVFLLLQSALQVLGPLLTKTAVDRYIAP
TGGQIPEFLARFLPADAWDGLTRIGLVYLTVLAANFVCEFIQMYVMQYTGQLAMFDLRRE
LMEHLQGLDLAFYDRNPVGRLVTRVTTDVDVLNELFASGLVTILGDILVLVFILAIMFSF
SPTLTAIMLTAMPFVILTTVIFRRSVSQSYRRIRVAIAKINSFLQEHITGIAVLQLFNRE
ERSCKEFEQVNREHMEAFKDAITAYGWFYPVVEFLSMMALAGILTYGGFRVQAGRLSLGV
VAAFLQYGLRFFRPIQDLSEKYNILQSAMASSERVFKLLDTEAAVLPPESAQPAPAGIAP
IEFDHVWFAYKDEDWVLRDVSFTIAPGETIAVVGHTGAGKTTLISLLLRFYDVQRGSIKV
GGVDVRLYGPLDLRRMFGVVLQDPYLFTGTLEENIRLGTENIRAEEVEAAAEQVNLMDFI
RTLPEGFGHTIRERGSGLSTGQKQLISFARALAHNPRYLILDEATSSVDTETEFRVREAL
NRMVAGRTSIVIAHRLSTIQRADRILVMHKGHLRESGTHQELLAQRGIYWKLYQLQYKDQ
ERVAAD
NT seq 1821 nt   +upstreamnt  +downstreamnt
gtggaagaagaggttcttggcaaggcatatgacgggcggctgatgcgccgcctgctcggg
tacatgcgtccctaccggttgctggtggcgctatcgctggttttcctgctgctgcaatcc
gcgttgcaagtgctgggaccgttgctgaccaaaacggcggtggaccgctacatcgcgccc
accggcggacaaatcccggagtttctggcgcgcttcctgccggccgacgcgtgggatggg
ctgacgcgaataggtctagtatacctaaccgtactggccgcaaatttcgtgtgcgagttc
attcagatgtatgtgatgcagtacacgggacagctggcgatgttcgatttgcggcgcgag
ctgatggagcacctgcagggacttgacctggccttctatgaccgcaatccggtggggcgg
ctggtgacccgggtgacgaccgacgtggacgtgctgaacgaactgttcgcatcagggctg
gtgacgattctcggcgacattctggtgctggtcttcattctggcgatcatgttcagcttc
agtccgacgctgacggcgatcatgttgacggcgatgccgttcgtgattctgacgacggtg
atcttccggcgcagcgtgtcgcagagctaccggcggatccgcgtggccatcgccaagatc
aactcattcttgcaggagcacattacgggcatcgcagtgctgcagttgttcaatcgcgaa
gaacgcagctgcaaggaattcgagcaggtgaatcgcgagcacatggaagcgttcaaggat
gcgatcacggcttacggatggttctatcctgtggtggaatttctctccatgatggcgctg
gccgggattctgacgtacggcggattccgggtgcaggcggggcggctttcgttgggagtg
gtagcggcgtttctgcagtatggactgcggttcttccggccgattcaggatttgagcgag
aagtacaacattctgcaatcggcgatggcgagttcggagcgggtgttcaagttgttggat
acggaggcggcggtgctgcccccggaatccgcgcagccggcgccggcggggatcgcgccg
atcgagttcgaccacgtatggttcgcgtataaggatgaggactgggtgttgcgtgacgtg
agctttacgatcgcgccgggagagacgatcgcggtggtggggcacacaggcgcgggcaag
actacgctgatcagcctgctgctgcgcttctatgacgtgcagagggggagcatcaaggtc
ggaggcgtggatgttcgcctatacggtccactggatctgcggcggatgttcggcgtggtg
ctgcaagatccctacctgttcacggggacgctggaagagaatatccggctcgggacagag
aacatccgcgccgaagaggtggaggcggcggcggagcaggtgaacctgatggattttatc
cgcacgctgcccgagggattcgggcacacgatccgggagcgcgggagcgggctatcgacg
ggtcagaagcagttgattagcttcgcgcgggcgctggcgcacaatccgcggtacctgatt
ttggatgaggcgacatcgagcgtggacacggagacggaatttcgcgtgcgggaagcgttg
aaccggatggtggcgggcaggacgtcgatcgtgattgcgcaccggctttcgacaattcag
cgggcggaccggattctggtgatgcataaggggcatctgcgcgagagcgggacgcaccag
gagttgctggcgcagcgggggatttactggaagttatatcagctgcaatataaggatcag
gagcgcgtggcggctgactga

DBGET integrated database retrieval system