Candidatus Solibacter usitatus: Acid_0500 Help Entry Acid_0500         CDS       T00412                                  Name (GenBank) caa(3)-type oxidase, subunit IV   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism sus  Candidatus Solibacter usitatus Pathway sus00190   Oxidative phosphorylation sus01100   Metabolic pathways Module sus_M00155   Cytochrome c oxidase, prokaryotes Brite KEGG Orthology (KO) [BR:sus00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Acid_0500 Enzymes [BR:sus01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      Acid_0500 SSDB OrthologParalogGFIT Motif Pfam:  COX4_pro Motif Other DBs NCBI-ProteinID:  ABJ81510 UniProt:  Q02BQ6 LinkDB All DBs Position 611612..611926 Genome browser AA seq 104 aa AA seqDB search MSSHDQQTHIDSAGTYVKILVTLLFLTGLTTAVAYVDLGAFSTVVALSIAVVKMLLVALF FMHVRHSTKLTKLVVVGGLLWLGILLALTMTDYFSRGLFGVVTN NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgagctctcacgaccaacagactcatatcgattccgccggaacttacgtcaaaatcctg gtcacgctcctctttctgaccggactcacgaccgcggtggcctacgtcgatctcggcgcc ttcagcacggtggttgcgctttccattgcggtggtgaagatgctgctggtggcgctcttc ttcatgcacgtccgccacagcaccaaattgaccaagctggtagtggtgggcggcctgctt tggctggggattctactggcgctgacgatgacggattacttcagtcgcggacttttcggc gtggtcaccaactag

DBGET integrated database retrieval system