Candidatus Solibacter usitatus: Acid_2644
Help
Entry
Acid_2644 CDS
T00412
Name
(GenBank) peptidase M56, BlaR1
KO
K02172
bla regulator protein blaR1
Organism
sus
Candidatus Solibacter usitatus
Pathway
sus01501
beta-Lactam resistance
Module
sus_M00627
beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:
sus00001
]
09160 Human Diseases
09175 Drug resistance: antimicrobial
01501 beta-Lactam resistance
Acid_2644
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
sus01002
]
Acid_2644
09183 Protein families: signaling and cellular processes
01504 Antimicrobial resistance genes [BR:
sus01504
]
Acid_2644
Peptidases and inhibitors [BR:
sus01002
]
Metallo peptidases
Family M56
Acid_2644
Antimicrobial resistance genes [BR:
sus01504
]
Gene sets
beta-Lactam resistance modules
beta-Lactam resistance, Bla system [MD:
M00627
]
Acid_2644
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_M56
CusB_dom_1
Peptidase_M48
Fn3_arc
Motif
Other DBs
NCBI-ProteinID:
ABJ83633
UniProt:
Q024E3
LinkDB
All DBs
Position
3343870..3345405
Genome browser
AA seq
511 aa
AA seq
DB search
MTTALAQPWAERLAWTLLHFIWQGTLWAAIYTVARLAAGRVTARARYAMACAALLGMALS
PAATYWWLAQSGIAASPTSALTPPNPQTVAAGFPYAADPWQAALPWIVMAWFAGVAACSV
RLAAGWISVSRLRSSHNRPPSAEWQHALQQLSERMRVRRPVRLLVSDRVESLSVIGWLRP
VILAPLGLLAGLAPDHVEALLAHELAHVRRHDYLVNLLQGIAESLLFYHPAVWWISGQIR
AEREHCCDDLAVAASGDVLTYARALAELESARPAHFNAALAANDGSLVRRIRRLIDPAAH
APSRPGAAWILSVLLLVAIGAVAMRAAQPASVARDSIWLDTVKLGDVVRQVRALGVLTSA
HTAELRVAETQMKEVAAGQPVTIAFQGRKDTVPCVLTRVRPGVANGVVTVDVQVEGPLPA
GIAAQSPVDATITIGRLSNVVHVARPVIGKANSEGTLFKIEPDGQTAVRINVQYGETSVN
TIEIKSGLQPGDKVIVSDMSAYDKYDRVTLK
NT seq
1536 nt
NT seq
+upstream
nt +downstream
nt
atgaccaccgcactcgcacaaccgtgggccgaacggctcgcctggactcttttgcacttc
atctggcagggaaccctgtgggccgcgatttacaccgtggctcgcctcgcggccggccgc
gtcactgcccgcgcccgctacgccatggcttgcgcggcactgctcggaatggcactgtcg
cccgccgctacctactggtggctggcgcaatccggcatcgcggcatcgcccacttcggca
ctcacccccccgaacccgcaaaccgtcgccgcgggctttccgtatgctgccgacccctgg
caagcggcgctgccttggatcgtcatggcctggttcgccggagtggccgcgtgctcggtc
cggctcgccgccggttggatctccgtctcccggctgcgctcttcccataaccgcccccct
tcagccgaatggcagcacgcgctccagcagctgagcgaacggatgcgcgtccgccggcct
gtccggctcctggtttcggatcgcgtggaatcgctctcggtgatcggatggctccgtccc
gtcatcctcgcgccgctgggcctgctcgccggcctcgcgccggatcacgtggaggcgctg
ctggcgcatgagctggcgcacgtccgccgtcacgattacctggtcaacctgctgcagggc
atcgccgagagcctgctcttctaccatcccgccgtgtggtggatctccggtcagatccgc
gccgaacgcgaacattgctgcgacgatctggccgtagccgcctcgggcgacgtgctcact
tacgcccgcgctctggccgagttggaatcggcccggcccgcgcacttcaacgccgccctc
gccgccaacgatggctcgctcgtgcgccgcatccgccgtctcatcgatccggccgctcac
gcgccatcccggccaggagcggcgtggatactgagcgtcttgctgctggtggccatcggt
gcagtggcaatgcgcgccgcccagcccgcttccgtggcacgcgattccatctggctcgac
accgtcaaactcggcgatgtcgtgcggcaagtgcgcgccctgggcgtactcacctccgcg
cacactgccgaattgcgcgtggcggaaacgcagatgaaagaggtcgcggcaggacaacct
gttacgatcgctttccaaggccgcaaggacacagtgccctgcgtactgacgcgggttcgt
cccggtgtcgccaatggagtcgtgaccgtggatgtgcaggtcgagggaccccttcccgcg
ggcatcgcggcgcagtctcccgtggatgccaccattaccatcgggcgtttgtctaatgtg
gtccatgtcgcccggccggttatcggtaaagcgaacagcgaaggcacgcttttcaaaatc
gagcccgacggccagaccgccgtccgcattaacgttcaatacggagagacctcggtcaac
accatcgaaatcaagagcggtctccaacccggcgacaaggtcatcgtcagcgatatgtcc
gcttacgacaaatacgaccgtgtgaccctgaagtag
DBGET
integrated database retrieval system