Candidatus Solibacter usitatus: Acid_7457 Help Entry Acid_7457         CDS       T00412                                  Name (GenBank) flagellar hook capping protein   KO K02389   flagellar basal-body rod modification protein FlgD Organism sus  Candidatus Solibacter usitatus Pathway sus02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:sus00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Acid_7457  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:sus02035]     Acid_7457 Bacterial motility proteins [BR:sus02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     Acid_7457 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgD Motif Other DBs NCBI-ProteinID:  ABJ88365 UniProt:  Q01PQ5 LinkDB All DBs Position 9348935..9349234 Genome browser AA seq 99 aa AA seqDB search MISGIQQNTAADSGTSAASTSTGGTSAVTKDMFLQLLVAQIKNQDPLSPTDGVQFLTQLA QFQQLEQSINMGQDVTAIRGDLDQLTTTPNPTDTTSTTI NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgatttcgggcatacagcaaaacacggctgcagattccggaacctctgccgccagcacc tcaacggggggaacatcggcagtcacaaaggatatgtttctgcagcttctggtggcgcag atcaaaaaccaggacccgctcagtccaaccgacggcgtacagttcctgacgcagctggcg cagttccagcaactggagcagtcgataaacatgggccaggatgttaccgccattcgcggc gacctggaccagctgacaacaaccccgaacccgaccgatacgacctcaaccaccatttga

DBGET integrated database retrieval system